BLASTX nr result
ID: Glycyrrhiza24_contig00015115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00015115 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616764.1| Indole-3-glycerol phosphate synthase [Medica... 62 5e-08 gb|AFK47745.1| unknown [Medicago truncatula] 62 6e-08 >ref|XP_003616764.1| Indole-3-glycerol phosphate synthase [Medicago truncatula] gi|355518099|gb|AES99722.1| Indole-3-glycerol phosphate synthase [Medicago truncatula] Length = 391 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -2 Query: 162 MEHLVSLKSPSQAFPSFSSKPRAWNVPPTQVNVYIKKPLFTFSVRAQVESNDGS 1 ME L+SLK FPSFSS PR +PPTQV Y K +FT SVRAQV+ N+GS Sbjct: 1 MEPLISLKGHFHVFPSFSSNPRT-TIPPTQVITYRKNSIFTLSVRAQVDPNEGS 53 >gb|AFK47745.1| unknown [Medicago truncatula] Length = 391 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -2 Query: 162 MEHLVSLKSPSQAFPSFSSKPRAWNVPPTQVNVYIKKPLFTFSVRAQVESNDGS 1 ME L+SLK FPSFSS PR +PPTQV Y K +FT SVRAQV+ N+GS Sbjct: 1 MEPLISLKGHFHVFPSFSSTPRT-TIPPTQVITYRKNSIFTLSVRAQVDPNEGS 53