BLASTX nr result
ID: Glycyrrhiza24_contig00015050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00015050 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529587.1| PREDICTED: monothiol glutaredoxin-S10-like [... 61 5e-11 gb|ABF69994.1| glutaredoxin family protein [Musa acuminata] 49 1e-10 gb|AFK43054.1| unknown [Lotus japonicus] 58 3e-10 ref|XP_003546093.1| PREDICTED: monothiol glutaredoxin-S10-like [... 58 3e-10 ref|XP_003542924.1| PREDICTED: monothiol glutaredoxin-S10-like [... 58 3e-10 >ref|XP_003529587.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max] Length = 102 Score = 61.2 bits (147), Expect(2) = 5e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 68 SRGKEIERCLVRQLGCNPSVPAVFIGGKFVGSANT 172 SRGKEIE CL+R LGCNPSVPAVFIGGKFVG+ NT Sbjct: 47 SRGKEIEWCLMR-LGCNPSVPAVFIGGKFVGAPNT 80 Score = 30.8 bits (68), Expect(2) = 5e-11 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 16 FYELGVGPAIYELD 57 FYELGVGP IYE+D Sbjct: 31 FYELGVGPTIYEVD 44 >gb|ABF69994.1| glutaredoxin family protein [Musa acuminata] Length = 103 Score = 48.9 bits (115), Expect(3) = 1e-10 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 71 RGKEIERCLVRQLGCNPSVPAVFIGGKFVGSAN 169 RG+E+E+ LV+ LG NPSVP VFIGGK VGS + Sbjct: 48 RGREMEKALVKLLGRNPSVPVVFIGGKLVGSTD 80 Score = 33.9 bits (76), Expect(3) = 1e-10 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 159 VPPTRTVMTLHLNGSLNRMLRDAGPLWL 242 V T +M LHL G L +LR+AG LWL Sbjct: 76 VGSTDRIMALHLGGKLTPLLREAGALWL 103 Score = 27.3 bits (59), Expect(3) = 1e-10 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 16 FYELGVGPAIYELD 57 F ELGV PA+YELD Sbjct: 31 FCELGVNPAVYELD 44 >gb|AFK43054.1| unknown [Lotus japonicus] Length = 102 Score = 58.2 bits (139), Expect(2) = 3e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 71 RGKEIERCLVRQLGCNPSVPAVFIGGKFVGSANT 172 RGKE+E L+R LGCNPSVPAVFIGGKFVGSANT Sbjct: 48 RGKEMEWALMR-LGCNPSVPAVFIGGKFVGSANT 80 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 16 FYELGVGPAIYELD 57 FYE GVGPAIYELD Sbjct: 31 FYEQGVGPAIYELD 44 >ref|XP_003546093.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max] Length = 102 Score = 58.2 bits (139), Expect(2) = 3e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 68 SRGKEIERCLVRQLGCNPSVPAVFIGGKFVGSANT 172 +RGKE+E L+R LGCNPSVPAVF+GGKFVGSANT Sbjct: 47 TRGKEMEWALLR-LGCNPSVPAVFVGGKFVGSANT 80 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 16 FYELGVGPAIYELD 57 FYE GVGPAIYELD Sbjct: 31 FYEQGVGPAIYELD 44 >ref|XP_003542924.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max] Length = 102 Score = 58.2 bits (139), Expect(2) = 3e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 68 SRGKEIERCLVRQLGCNPSVPAVFIGGKFVGSANT 172 +RGKE+E L+R LGCNPSVPAVF+GGKFVGSANT Sbjct: 47 TRGKEMEWALMR-LGCNPSVPAVFVGGKFVGSANT 80 Score = 31.2 bits (69), Expect(2) = 3e-10 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 16 FYELGVGPAIYELD 57 FYE GVGPAIYELD Sbjct: 31 FYEQGVGPAIYELD 44