BLASTX nr result
ID: Glycyrrhiza24_contig00014862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00014862 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601293.1| Pentatricopeptide repeat-containing protein,... 133 1e-29 ref|XP_003539180.1| PREDICTED: pentatricopeptide repeat-containi... 114 8e-24 ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-23 ref|XP_004152457.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 ref|XP_002511467.1| pentatricopeptide repeat-containing protein,... 102 4e-20 >ref|XP_003601293.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] gi|355490341|gb|AES71544.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] Length = 317 Score = 133 bits (335), Expect = 1e-29 Identities = 61/75 (81%), Positives = 70/75 (93%) Frame = +2 Query: 2 KHLDRHKTYIHSSSGFDNAIDIAARMRDYNTAWALVGRMRALRRGPTPRTFAIIAERYAT 181 KHLDRH TYIHS S F++A+DIAAR+R+YNTAWAL+GRMRALR GPTP+TFAI+AERYAT Sbjct: 88 KHLDRHPTYIHSISSFEHAVDIAARLREYNTAWALMGRMRALRLGPTPKTFAILAERYAT 147 Query: 182 GGKAHRAVKVFLCMH 226 GGKAH+AVKVFL MH Sbjct: 148 GGKAHKAVKVFLSMH 162 >ref|XP_003539180.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Glycine max] Length = 492 Score = 114 bits (285), Expect = 8e-24 Identities = 54/76 (71%), Positives = 65/76 (85%), Gaps = 1/76 (1%) Frame = +2 Query: 2 KHLDRH-KTYIHSSSGFDNAIDIAARMRDYNTAWALVGRMRALRRGPTPRTFAIIAERYA 178 KHLDRH +Y HS S FD+A+DIAARMRD+N+AWALVGRMR+LR GP+P+T AI+AERYA Sbjct: 88 KHLDRHLPSYTHSPSSFDHAVDIAARMRDFNSAWALVGRMRSLRLGPSPKTLAILAERYA 147 Query: 179 TGGKAHRAVKVFLCMH 226 + GK HRAV+ FL MH Sbjct: 148 SIGKPHRAVRTFLSMH 163 >ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Glycine max] Length = 495 Score = 112 bits (281), Expect = 2e-23 Identities = 53/75 (70%), Positives = 64/75 (85%), Gaps = 1/75 (1%) Frame = +2 Query: 2 KHLDRHK-TYIHSSSGFDNAIDIAARMRDYNTAWALVGRMRALRRGPTPRTFAIIAERYA 178 KHLDRH +Y HS S FD+A+DIAARMRD+N+AWALVGRMR+LR GP+P+T AI+AERYA Sbjct: 91 KHLDRHHPSYTHSPSSFDHAVDIAARMRDFNSAWALVGRMRSLRLGPSPKTLAILAERYA 150 Query: 179 TGGKAHRAVKVFLCM 223 + GK HRAV+ FL M Sbjct: 151 SNGKPHRAVRTFLSM 165 >ref|XP_004152457.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Cucumis sativus] gi|449487784|ref|XP_004157799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Cucumis sativus] Length = 502 Score = 103 bits (257), Expect = 1e-20 Identities = 49/74 (66%), Positives = 57/74 (77%) Frame = +2 Query: 2 KHLDRHKTYIHSSSGFDNAIDIAARMRDYNTAWALVGRMRALRRGPTPRTFAIIAERYAT 181 KHL+ H +Y HS+S FD+AIDIA RMRDY T WALV RMRA R GP+ +TFAIIAER+ Sbjct: 100 KHLEYHPSYAHSASSFDHAIDIAGRMRDYKTVWALVARMRARRIGPSSKTFAIIAERFVA 159 Query: 182 GGKAHRAVKVFLCM 223 GK RA+KVFL M Sbjct: 160 AGKPDRAIKVFLSM 173 >ref|XP_002511467.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550582|gb|EEF52069.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 482 Score = 102 bits (253), Expect = 4e-20 Identities = 48/75 (64%), Positives = 56/75 (74%) Frame = +2 Query: 2 KHLDRHKTYIHSSSGFDNAIDIAARMRDYNTAWALVGRMRALRRGPTPRTFAIIAERYAT 181 K L H +Y H +S FD+AIDI AR+RD+ T W LV RMR+ R GP+PRTFAIIAERYA Sbjct: 80 KILSHHPSYCHQASSFDHAIDICARLRDFRTLWFLVSRMRSCRLGPSPRTFAIIAERYAA 139 Query: 182 GGKAHRAVKVFLCMH 226 GK HRAV VF+ MH Sbjct: 140 MGKPHRAVTVFMSMH 154