BLASTX nr result
ID: Glycyrrhiza24_contig00014850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00014850 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555919.1| PREDICTED: reticulon-like protein B9-like [G... 54 1e-05 >ref|XP_003555919.1| PREDICTED: reticulon-like protein B9-like [Glycine max] Length = 211 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +3 Query: 171 MPTRSHQPAQSYSPGFFGRQRQLHALLGGGKIADILLW 284 MP RS +PAQ PG RQR LHA+LGGGK+ADILLW Sbjct: 1 MPIRSREPAQR--PGLLDRQRPLHAVLGGGKLADILLW 36