BLASTX nr result
ID: Glycyrrhiza24_contig00014597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00014597 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615969.1| Pseudouridylate synthase [Medicago truncatul... 65 7e-09 ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synth... 58 7e-07 ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synth... 56 3e-06 >ref|XP_003615969.1| Pseudouridylate synthase [Medicago truncatula] gi|355517304|gb|AES98927.1| Pseudouridylate synthase [Medicago truncatula] Length = 483 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 275 EKLDRYSSIPDAQLEEVRRGWRAWKENFKAKPASDA 168 EKLD+YSSIP+ QLEEVR WR WKENF+AKPAS+A Sbjct: 448 EKLDKYSSIPNDQLEEVREAWRTWKENFRAKPASEA 483 >ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] Length = 516 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 275 EKLDRYSSIPDAQLEEVRRGWRAWKENFKAKPASDA 168 E LD+YSSIPDA+L+EVR+ W+ WKENF+ K AS A Sbjct: 481 ENLDKYSSIPDAELDEVRKAWKTWKENFRLKSASKA 516 >ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] Length = 518 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -1 Query: 275 EKLDRYSSIPDAQLEEVRRGWRAWKENFKAKPASDA 168 E LD+YSSIPD +L+EVR+ W+ WKENF+ K S+A Sbjct: 483 ENLDKYSSIPDVELDEVRKAWKTWKENFRVKSESEA 518