BLASTX nr result
ID: Glycyrrhiza24_contig00013941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013941 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum... 115 3e-24 ref|ZP_01951366.1| conserved hypothetical protein [Vibrio choler... 112 1e-23 ref|ZP_14354411.1| hypothetical protein VCHC1A2_3330 [Vibrio cho... 105 1e-21 ref|ZP_01678976.1| conserved hypothetical protein [Vibrio choler... 105 1e-21 ref|ZP_01980035.1| conserved hypothetical protein [Vibrio choler... 105 2e-21 >emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] Length = 259 Score = 115 bits (289), Expect = 3e-24 Identities = 70/119 (58%), Positives = 83/119 (69%) Frame = -3 Query: 360 YLALEDGPPIFRQSFSCSVLLDFMTKRFSRTGLSPTMAALSRAFR*NQSHLRASPRSLAT 181 YL LEDGPP+FRQ F+C LL T RF+ TGLSP MA LSR FR + PRSLAT Sbjct: 120 YLGLEDGPPMFRQDFTCPALLKADT-RFTPTGLSPAMARLSRRFRLCKYQHWPGPRSLAT 178 Query: 180 TKGISVDFFSSGYLDVSVPLVRSIHLCIQCKVTIL*WLGSPIRTSPDQSLFADSPKLFA 4 T G+SVD SSGYLDVSV VR ++LCIQ ++T L W G PIR S DQSL + +P+ F+ Sbjct: 179 TNGVSVDVLSSGYLDVSVRPVRLLNLCIQFRIT-LRW-GFPIRISTDQSLLS-APRGFS 234 >ref|ZP_01951366.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124113369|gb|EAY32189.1| conserved hypothetical protein [Vibrio cholerae 1587] Length = 171 Score = 112 bits (280), Expect(2) = 1e-23 Identities = 61/93 (65%), Positives = 66/93 (70%) Frame = -3 Query: 360 YLALEDGPPIFRQSFSCSVLLDFMTKRFSRTGLSPTMAALSRAFR*NQSHLRASPRSLAT 181 YLALEDGPPIFRQ +C LLDF S TGLSP +A LS F LRA+P SLA Sbjct: 36 YLALEDGPPIFRQDITCPALLDFTLDEASVTGLSPCIAKLSSLFTYFTECLRANPGSLAA 95 Query: 180 TKGISVDFFSSGYLDVSVPLVRSIHLCIQCKVT 82 T GISVDFFSSGYLDVSVP V S++LCIQ VT Sbjct: 96 TTGISVDFFSSGYLDVSVPPVCSVNLCIQLTVT 128 Score = 21.9 bits (45), Expect(2) = 1e-23 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 67 GFPHSDISGSKSVCRLPEAFRR 2 GFPHS+I+ S L A+R+ Sbjct: 133 GFPHSEIADSNGSYCLICAYRK 154 >ref|ZP_14354411.1| hypothetical protein VCHC1A2_3330 [Vibrio cholerae HC-1A2] gi|408619428|gb|EKK92457.1| hypothetical protein VCHC1A2_3330 [Vibrio cholerae HC-1A2] Length = 133 Score = 105 bits (263), Expect(2) = 1e-21 Identities = 57/90 (63%), Positives = 63/90 (70%) Frame = -3 Query: 351 LEDGPPIFRQSFSCSVLLDFMTKRFSRTGLSPTMAALSRAFR*NQSHLRASPRSLATTKG 172 +EDGPPIFRQ +C LLDF S TGLSP +A LS F LRA+P SLA T G Sbjct: 1 MEDGPPIFRQDITCPALLDFTLDEASVTGLSPCIAKLSSLFTYFTECLRANPDSLAATTG 60 Query: 171 ISVDFFSSGYLDVSVPLVRSIHLCIQCKVT 82 ISVDFFSSGYLDVSVP V S++LCIQ VT Sbjct: 61 ISVDFFSSGYLDVSVPPVCSVNLCIQLTVT 90 Score = 21.9 bits (45), Expect(2) = 1e-21 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 67 GFPHSDISGSKSVCRLPEAFRR 2 GFPHS+I+ S L A+R+ Sbjct: 95 GFPHSEIADSNGSYCLICAYRK 116 >ref|ZP_01678976.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121730781|ref|ZP_01682868.1| conserved hypothetical protein [Vibrio cholerae V52] gi|121730795|ref|ZP_01682876.1| serine acetyltransferase [Vibrio cholerae V52] gi|153217595|ref|ZP_01951276.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153217785|ref|ZP_01951428.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153803669|ref|ZP_01958255.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|153803744|ref|ZP_01958330.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|153824265|ref|ZP_01976932.1| conserved hypothetical protein [Vibrio cholerae B33] gi|153827712|ref|ZP_01980379.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153827713|ref|ZP_01980380.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153829103|ref|ZP_01981770.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|419827856|ref|ZP_14351349.1| hypothetical protein VCHC1A2_0179 [Vibrio cholerae HC-1A2] gi|419828962|ref|ZP_14352452.1| hypothetical protein VCHC1A2_1314 [Vibrio cholerae HC-1A2] gi|419829327|ref|ZP_14352815.1| hypothetical protein VCHC1A2_1704 [Vibrio cholerae HC-1A2] gi|419831180|ref|ZP_14354662.1| hypothetical protein VCHC1A2_3588 [Vibrio cholerae HC-1A2] gi|121546362|gb|EAX56623.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121627630|gb|EAX60309.1| serine acetyltransferase [Vibrio cholerae V52] gi|121627645|gb|EAX60318.1| conserved hypothetical protein [Vibrio cholerae V52] gi|124113307|gb|EAY32127.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124113457|gb|EAY32277.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124120720|gb|EAY39463.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|124120795|gb|EAY39538.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|126518212|gb|EAZ75437.1| conserved hypothetical protein [Vibrio cholerae B33] gi|148875431|gb|EDL73566.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|149737811|gb|EDM52716.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|149737812|gb|EDM52717.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|408619138|gb|EKK92178.1| hypothetical protein VCHC1A2_3588 [Vibrio cholerae HC-1A2] gi|408621961|gb|EKK94953.1| hypothetical protein VCHC1A2_1704 [Vibrio cholerae HC-1A2] gi|408622559|gb|EKK95542.1| hypothetical protein VCHC1A2_1314 [Vibrio cholerae HC-1A2] gi|408624607|gb|EKK97551.1| hypothetical protein VCHC1A2_0179 [Vibrio cholerae HC-1A2] Length = 133 Score = 105 bits (263), Expect(2) = 1e-21 Identities = 57/90 (63%), Positives = 63/90 (70%) Frame = -3 Query: 351 LEDGPPIFRQSFSCSVLLDFMTKRFSRTGLSPTMAALSRAFR*NQSHLRASPRSLATTKG 172 +EDGPPIFRQ +C LLDF S TGLSP +A LS F LRA+P SLA T G Sbjct: 1 MEDGPPIFRQDITCPALLDFTLDEASVTGLSPCIAKLSSLFTYFTECLRANPGSLAATTG 60 Query: 171 ISVDFFSSGYLDVSVPLVRSIHLCIQCKVT 82 ISVDFFSSGYLDVSVP V S++LCIQ VT Sbjct: 61 ISVDFFSSGYLDVSVPPVCSVNLCIQLTVT 90 Score = 21.9 bits (45), Expect(2) = 1e-21 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 67 GFPHSDISGSKSVCRLPEAFRR 2 GFPHS+I+ S L A+R+ Sbjct: 95 GFPHSEIADSNGSYCLICAYRK 116 >ref|ZP_01980035.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|149738717|gb|EDM53059.1| conserved hypothetical protein [Vibrio cholerae MZO-2] Length = 133 Score = 105 bits (261), Expect(2) = 2e-21 Identities = 57/90 (63%), Positives = 63/90 (70%) Frame = -3 Query: 351 LEDGPPIFRQSFSCSVLLDFMTKRFSRTGLSPTMAALSRAFR*NQSHLRASPRSLATTKG 172 +EDGPPIFRQ +C LLDF S TGLSP +A LS F LRA+P SLA T G Sbjct: 1 MEDGPPIFRQDITCPALLDFTLDEASVTGLSPCIAKLSSLFTYFIECLRANPGSLAATTG 60 Query: 171 ISVDFFSSGYLDVSVPLVRSIHLCIQCKVT 82 ISVDFFSSGYLDVSVP V S++LCIQ VT Sbjct: 61 ISVDFFSSGYLDVSVPPVCSVNLCIQLTVT 90 Score = 21.9 bits (45), Expect(2) = 2e-21 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 67 GFPHSDISGSKSVCRLPEAFRR 2 GFPHS+I+ S L A+R+ Sbjct: 95 GFPHSEIADSNGSYCLICAYRK 116