BLASTX nr result
ID: Glycyrrhiza24_contig00013879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013879 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4... 113 2e-23 ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4... 109 4e-22 ref|XP_003557013.1| PREDICTED: U-box domain-containing protein 4... 107 1e-21 ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 105 5e-21 emb|CBI19404.3| unnamed protein product [Vitis vinifera] 103 2e-20 >ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449482708|ref|XP_004156379.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Length = 352 Score = 113 bits (282), Expect = 2e-23 Identities = 59/66 (89%), Positives = 61/66 (92%) Frame = -2 Query: 568 AAVILLQICEDSVVYRTMVCREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAA 389 AAVILLQICEDSV+YRTMV REGAIPPLVALSQSGTNRAKQKAE LIELLRQPRSGN AA Sbjct: 286 AAVILLQICEDSVLYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNYAA 345 Query: 388 RTSQMS 371 TS +S Sbjct: 346 TTSDVS 351 >ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 352 Score = 109 bits (272), Expect = 4e-22 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -2 Query: 568 AAVILLQICEDSVVYRTMVCREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAA 389 A VILLQ+CEDSV YRTMV REGAIPPLVALSQSGTNRAKQKAE LIELLRQPRSGN AA Sbjct: 285 AVVILLQVCEDSVTYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNGAA 344 Query: 388 RTS 380 R++ Sbjct: 345 RST 347 >ref|XP_003557013.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 319 Score = 107 bits (268), Expect = 1e-21 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = -2 Query: 562 VILLQICEDSVVYRTMVCREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAART 383 VILLQ+CEDSV YRTMV REGAIPPLVALSQSGTNRAKQKAE LIELLRQPRSG A RT Sbjct: 255 VILLQVCEDSVAYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGYGAVRT 314 Query: 382 SQMSA 368 S++ A Sbjct: 315 SEVVA 319 >ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223550800|gb|EEF52286.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 352 Score = 105 bits (262), Expect = 5e-21 Identities = 53/66 (80%), Positives = 59/66 (89%) Frame = -2 Query: 568 AAVILLQICEDSVVYRTMVCREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAA 389 A ILLQICED+++ R MV REGAIPPL+ALSQSGTNRAKQKAETLI+LLRQPRSGNAAA Sbjct: 286 AVAILLQICEDNLMRRAMVVREGAIPPLIALSQSGTNRAKQKAETLIDLLRQPRSGNAAA 345 Query: 388 RTSQMS 371 RT +S Sbjct: 346 RTPDVS 351 >emb|CBI19404.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 103 bits (257), Expect = 2e-20 Identities = 52/66 (78%), Positives = 56/66 (84%) Frame = -2 Query: 568 AAVILLQICEDSVVYRTMVCREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAA 389 A ILLQICEDS+ YR MV REGAIPPLVALSQS NR+KQKAE LI+LLRQPRSGN AA Sbjct: 322 AVAILLQICEDSLAYRNMVAREGAIPPLVALSQSSANRSKQKAEALIDLLRQPRSGNVAA 381 Query: 388 RTSQMS 371 RTS +S Sbjct: 382 RTSDVS 387