BLASTX nr result
ID: Glycyrrhiza24_contig00013630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013630 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncat... 79 9e-15 ref|YP_588403.1| hypothetical protein ZeamMp158 [Zea mays subsp.... 55 1e-08 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 62 5e-08 >ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula] gi|355477374|gb|AES58577.1| ATP synthase subunit alpha [Medicago truncatula] Length = 1116 Score = 79.3 bits (194), Expect(2) = 9e-15 Identities = 45/83 (54%), Positives = 47/83 (56%) Frame = -2 Query: 249 FVSEPFWRGVLNPLRTTPPGGSPECRVFLRRQLDVVVTRKRRPKTGLY*TSEKTFYLVKQ 70 F S FWRGVLNPLRTTPPGGSPECRVFLRRQLDVV+T KR T + Sbjct: 706 FRSRLFWRGVLNPLRTTPPGGSPECRVFLRRQLDVVLTCKRSKATSKGLSC--------- 756 Query: 69 QARD*AARNFIYLRRFAHPFSCS 1 FAHPFSCS Sbjct: 757 --------------AFAHPFSCS 765 Score = 25.4 bits (54), Expect(2) = 9e-15 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 269 VRHAPFSLFRSR 234 +RHAPF LFRSR Sbjct: 698 LRHAPFCLFRSR 709 >ref|YP_588403.1| hypothetical protein ZeamMp158 [Zea mays subsp. mays] gi|40795104|gb|AAR91148.1| hypothetical protein (mitochondrion) [Zea mays] Length = 111 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 3/37 (8%) Frame = +3 Query: 213 GLVRPAKT---APKQTKRCMPHSRGTASEILEEGGDD 314 G+VR + APKQ KRC+PHSRGTASEILEEGGDD Sbjct: 28 GVVRSGNSTRPAPKQRKRCVPHSRGTASEILEEGGDD 64 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 182 GEPPGGVVRSGFST 223 G+PPGGVVRSG ST Sbjct: 23 GQPPGGVVRSGNST 36 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 225 PAKTAPKQTKRCMPHSRGTASEILEEGGDD 314 P +TAPKQTKRCMPHSRGTAS+ILEEGGDD Sbjct: 391 PKQTAPKQTKRCMPHSRGTASDILEEGGDD 420