BLASTX nr result
ID: Glycyrrhiza24_contig00013402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013402 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549972.1| PREDICTED: type I inositol-1,4,5-trisphospha... 80 2e-13 ref|XP_003525602.1| PREDICTED: type I inositol-1,4,5-trisphospha... 80 2e-13 ref|XP_002279188.2| PREDICTED: type I inositol-1,4,5-trisphospha... 80 2e-13 ref|XP_003538770.1| PREDICTED: type I inositol-1,4,5-trisphospha... 79 4e-13 ref|XP_004150174.1| PREDICTED: type I inositol 1,4,5-trisphospha... 79 5e-13 >ref|XP_003549972.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 2-like [Glycine max] Length = 629 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 323 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTETES 448 MK +RG+RSEAFWPS++MKKWLNIK K YDFSEDEVDTETES Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTETES 42 >ref|XP_003525602.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 2-like [Glycine max] Length = 596 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 323 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTETES 448 MK +RG+RSEAFWPS++MKKWLNIK K YDFSEDEVDTETES Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDTETES 42 >ref|XP_002279188.2| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 2-like [Vitis vinifera] gi|297742162|emb|CBI33949.3| unnamed protein product [Vitis vinifera] Length = 628 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +2 Query: 323 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTETES 448 M+ ++G+RSEAFWPSI+MKKWLNIK KAYDFSEDEVDTETES Sbjct: 1 MRTRQGKRSEAFWPSIVMKKWLNIKPKAYDFSEDEVDTETES 42 >ref|XP_003538770.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 2-like [Glycine max] Length = 597 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +2 Query: 323 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTETES 448 MKA+RG+RSEAFWPSI+MKKWLNIK K DFSEDEVDTETES Sbjct: 1 MKARRGKRSEAFWPSIVMKKWLNIKPKVNDFSEDEVDTETES 42 >ref|XP_004150174.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Cucumis sativus] gi|449530138|ref|XP_004172053.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Cucumis sativus] Length = 636 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 323 MKAKRGRRSEAFWPSIMMKKWLNIKQKAYDFSEDEVDTETES 448 M+ ++G+RSEAFWPSI+MKKWLNIK K YDFSEDEVDTETES Sbjct: 1 MRTRKGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTETES 42