BLASTX nr result
ID: Glycyrrhiza24_contig00013399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013399 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617132.1| Heterogeneous nuclear ribonucleoprotein D0 [... 66 1e-18 ref|XP_003519490.1| PREDICTED: uncharacterized protein LOC100792... 85 5e-15 ref|XP_003545465.1| PREDICTED: uncharacterized protein LOC100783... 84 2e-14 ref|XP_003632233.1| PREDICTED: uncharacterized protein LOC100258... 67 2e-09 >ref|XP_003617132.1| Heterogeneous nuclear ribonucleoprotein D0 [Medicago truncatula] gi|355518467|gb|AET00091.1| Heterogeneous nuclear ribonucleoprotein D0 [Medicago truncatula] Length = 523 Score = 66.2 bits (160), Expect(2) = 1e-18 Identities = 32/41 (78%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 474 GNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPG-AGAPYM 355 GNQAAM YG Q G+QP YQNPQ+GQS GVRPHPG GAPYM Sbjct: 456 GNQAAMGYG-QPGLQPQYQNPQLGQSGGVRPHPGPGGAPYM 495 Score = 51.6 bits (122), Expect(2) = 1e-18 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 349 LDTLIDASII*FWTPLILLKYQALFKCIF 263 +DTLIDAS I FWT LILLKYQALFKCIF Sbjct: 495 MDTLIDASNILFWTLLILLKYQALFKCIF 523 >ref|XP_003519490.1| PREDICTED: uncharacterized protein LOC100792637 [Glycine max] Length = 496 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -2 Query: 471 NQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 349 NQ AM YGNQ MQPGYQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 456 NQPAMGYGNQPAMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 496 >ref|XP_003545465.1| PREDICTED: uncharacterized protein LOC100783742 [Glycine max] Length = 494 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 471 NQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 349 NQ AM YGNQ MQPGYQNPQMGQ SGVRPHPGAGAPYMGH Sbjct: 454 NQPAMGYGNQPAMQPGYQNPQMGQGSGVRPHPGAGAPYMGH 494 >ref|XP_003632233.1| PREDICTED: uncharacterized protein LOC100258161 isoform 1 [Vitis vinifera] gi|359479207|ref|XP_003632234.1| PREDICTED: uncharacterized protein LOC100258161 isoform 2 [Vitis vinifera] gi|147853236|emb|CAN80681.1| hypothetical protein VITISV_037734 [Vitis vinifera] Length = 478 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -2 Query: 474 GNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 349 GNQ A SYG+Q GMQ GYQNPQMGQ+SG RP G GAPYMGH Sbjct: 438 GNQGAGSYGSQPGMQGGYQNPQMGQASGGRPQQG-GAPYMGH 478