BLASTX nr result
ID: Glycyrrhiza24_contig00013310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013310 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607988.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 gb|AFK42502.1| unknown [Medicago truncatula] 71 1e-10 ref|XP_003518842.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 >ref|XP_003607988.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355509043|gb|AES90185.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 565 Score = 71.6 bits (174), Expect = 6e-11 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 7/68 (10%) Frame = +2 Query: 23 MATFPLIQRARTTMLSSSS--FKLRTNSISIHANY----LSTSALPNEYGRFPPRQ-QSP 181 MATFPLI RARTTMLSSSS F L+ S IH N+ LSTSA+PNEYGR PP Q Q P Sbjct: 1 MATFPLIHRARTTMLSSSSSFFSLKLRSNYIHGNHFCKTLSTSAIPNEYGRLPPHQVQQP 60 Query: 182 SASDPTHF 205 + HF Sbjct: 61 PSDHNQHF 68 >gb|AFK42502.1| unknown [Medicago truncatula] Length = 565 Score = 70.9 bits (172), Expect = 1e-10 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 7/68 (10%) Frame = +2 Query: 23 MATFPLIQRARTTMLSSSS--FKLRTNSISIHANY----LSTSALPNEYGRFPP-RQQSP 181 MATFPLI RARTTMLSSSS F L+ S IH N+ LSTSA+PNEYGR PP R Q P Sbjct: 1 MATFPLIHRARTTMLSSSSSFFSLKLRSNYIHGNHFCKTLSTSAIPNEYGRLPPHRVQQP 60 Query: 182 SASDPTHF 205 + HF Sbjct: 61 PSDHNQHF 68 >ref|XP_003518842.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Glycine max] Length = 591 Score = 67.8 bits (164), Expect = 9e-10 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 8/70 (11%) Frame = +2 Query: 23 MATFPLIQRARTTMLSSSSFKLRTNSI-------SIHANYLSTSALPNEYGRFPPRQ-QS 178 MATF IQRARTTML SSSFKLRT+ + ++ N LSTSALP+EY RFP +Q Q Sbjct: 1 MATFTSIQRARTTML-SSSFKLRTHLLHGNHFTQTLTTNSLSTSALPHEYQRFPSQQNQH 59 Query: 179 PSASDPTHFQ 208 SDP+HFQ Sbjct: 60 QPPSDPSHFQ 69 >ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Glycine max] Length = 588 Score = 62.4 bits (150), Expect = 4e-08 Identities = 41/70 (58%), Positives = 47/70 (67%), Gaps = 8/70 (11%) Frame = +2 Query: 23 MATFPLIQRARTTMLSSSSFKLRTNSI-------SIHANYLSTSALPNEYGRFPPRQ-QS 178 MATF IQRARTTML SSSFKLRT+ I ++ L+TSALP+EY RFP +Q Q Sbjct: 1 MATFTSIQRARTTML-SSSFKLRTHLIYGNHFTQTLTTKSLTTSALPHEYQRFPSQQNQH 59 Query: 179 PSASDPTHFQ 208 SDPT FQ Sbjct: 60 QPPSDPTLFQ 69