BLASTX nr result
ID: Glycyrrhiza24_contig00013108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00013108 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540937.1| PREDICTED: indole-3-acetic acid-induced prot... 94 9e-18 ref|XP_004144827.1| PREDICTED: indole-3-acetic acid-induced prot... 87 2e-15 ref|XP_003607090.1| Auxin-induced protein 6B [Medicago truncatul... 84 2e-14 ref|XP_002513015.1| Indole-3-acetic acid-induced protein ARG7, p... 82 4e-14 gb|AFK48909.1| unknown [Medicago truncatula] 81 1e-13 >ref|XP_003540937.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine max] Length = 137 Score = 94.4 bits (233), Expect = 9e-18 Identities = 46/71 (64%), Positives = 54/71 (76%), Gaps = 1/71 (1%) Frame = +3 Query: 3 EEEYGFYNQGPLTIPCDESLFQDLLRVMSRSEST-RFSTIDDFRRRCHVDVPNFLDPVGE 179 EEEYGF N GPL IPCDESLF++LLRV+SR FST++DF+RRCH+DV D VGE Sbjct: 67 EEEYGFCNHGPLAIPCDESLFEELLRVVSRPVPVPGFSTLEDFQRRCHMDVSTGFDVVGE 126 Query: 180 STPLLHDQLIC 212 S PLL D+ IC Sbjct: 127 SWPLLRDEPIC 137 >ref|XP_004144827.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis sativus] gi|449525722|ref|XP_004169865.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis sativus] Length = 151 Score = 86.7 bits (213), Expect = 2e-15 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = +3 Query: 3 EEEYGFYNQGPLTIPCDESLFQDLLRVMSRSESTRFSTIDDFRRRCHVDVPNFLDPVGES 182 EEEYGF NQGPL IPC+ES+F+++LR +SRSES RF + D RRRCHVD P+ L + ES Sbjct: 80 EEEYGFRNQGPLAIPCEESVFEEVLRTVSRSESGRFLNLQDIRRRCHVDSPSGL--LRES 137 Query: 183 TPLLHD 200 PLL D Sbjct: 138 RPLLFD 143 >ref|XP_003607090.1| Auxin-induced protein 6B [Medicago truncatula] gi|355508145|gb|AES89287.1| Auxin-induced protein 6B [Medicago truncatula] Length = 139 Score = 83.6 bits (205), Expect = 2e-14 Identities = 43/70 (61%), Positives = 51/70 (72%) Frame = +3 Query: 3 EEEYGFYNQGPLTIPCDESLFQDLLRVMSRSESTRFSTIDDFRRRCHVDVPNFLDPVGES 182 EEEYGF N GPL IPCDE F+++LRVM+R E RFST++DF+RRCHVDV + ES Sbjct: 73 EEEYGFCNHGPLAIPCDEFEFEEILRVMARPE-FRFSTVEDFQRRCHVDVRS--SNSCES 129 Query: 183 TPLLHDQLIC 212 PLL D IC Sbjct: 130 RPLLRDDSIC 139 >ref|XP_002513015.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus communis] gi|223548026|gb|EEF49518.1| Indole-3-acetic acid-induced protein ARG7, putative [Ricinus communis] Length = 142 Score = 82.4 bits (202), Expect = 4e-14 Identities = 41/67 (61%), Positives = 54/67 (80%), Gaps = 2/67 (2%) Frame = +3 Query: 3 EEEYGFYNQGPLTIPCDESLFQDLLRVM-SRSESTRFSTIDDFRRRCHVD-VPNFLDPVG 176 EEEYGF N GPLTIPCDES+F+++LRV+ SRSES RFS +++ +R CHVD + + L+ + Sbjct: 75 EEEYGFKNIGPLTIPCDESVFEEILRVVSSRSESLRFSNVEEVQRCCHVDIIRSHLEFLS 134 Query: 177 ESTPLLH 197 ES PLLH Sbjct: 135 ESRPLLH 141 >gb|AFK48909.1| unknown [Medicago truncatula] Length = 139 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/70 (60%), Positives = 50/70 (71%) Frame = +3 Query: 3 EEEYGFYNQGPLTIPCDESLFQDLLRVMSRSESTRFSTIDDFRRRCHVDVPNFLDPVGES 182 EEEYGF N GPL IPCDE F+++LRVM+R E FST++DF+RRCHVDV + ES Sbjct: 73 EEEYGFCNHGPLAIPCDEFEFEEILRVMARPE-FGFSTVEDFQRRCHVDVRS--SNSCES 129 Query: 183 TPLLHDQLIC 212 PLL D IC Sbjct: 130 RPLLRDDSIC 139