BLASTX nr result
ID: Glycyrrhiza24_contig00012827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012827 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528705.1| PREDICTED: LOW QUALITY PROTEIN: tonoplast di... 58 7e-07 >ref|XP_003528705.1| PREDICTED: LOW QUALITY PROTEIN: tonoplast dicarboxylate transporter-like [Glycine max] Length = 311 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 296 SLLMPTLGAYVFGTNDGIQWMPNKNSPWLRN 204 S+ MPTLGA VFGT+D IQWMPN NSPWLRN Sbjct: 281 SIFMPTLGAIVFGTDDYIQWMPNINSPWLRN 311