BLASTX nr result
ID: Glycyrrhiza24_contig00012332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012332 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO53615.1| biotin carboxyl carrier protein 2-5 [Arachis hypo... 78 9e-13 gb|ACO53614.1| biotin carboxyl carrier protein 2-4 [Arachis hypo... 78 9e-13 gb|ACO53613.1| biotin carboxyl carrier protein 2-3 [Arachis hypo... 78 9e-13 gb|ACO53612.1| biotin carboxyl carrier protein 2-2 [Arachis hypo... 78 9e-13 gb|ACO53611.1| biotin carboxyl carrier protein 2-1 [Arachis hypo... 78 9e-13 >gb|ACO53615.1| biotin carboxyl carrier protein 2-5 [Arachis hypogaea] Length = 276 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 259 ISAFMAQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALE 137 +SAFMAQV+DLVKLVDSRDIVELQLKQSDCELMIRKKEALE Sbjct: 102 VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEALE 142 >gb|ACO53614.1| biotin carboxyl carrier protein 2-4 [Arachis hypogaea] Length = 276 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 259 ISAFMAQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALE 137 +SAFMAQV+DLVKLVDSRDIVELQLKQSDCELMIRKKEALE Sbjct: 102 VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEALE 142 >gb|ACO53613.1| biotin carboxyl carrier protein 2-3 [Arachis hypogaea] Length = 276 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 259 ISAFMAQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALE 137 +SAFMAQV+DLVKLVDSRDIVELQLKQSDCELMIRKKEALE Sbjct: 102 VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEALE 142 >gb|ACO53612.1| biotin carboxyl carrier protein 2-2 [Arachis hypogaea] Length = 276 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 259 ISAFMAQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALE 137 +SAFMAQV+DLVKLVDSRDIVELQLKQSDCELMIRKKEALE Sbjct: 102 VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEALE 142 >gb|ACO53611.1| biotin carboxyl carrier protein 2-1 [Arachis hypogaea] Length = 276 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 259 ISAFMAQVSDLVKLVDSRDIVELQLKQSDCELMIRKKEALE 137 +SAFMAQV+DLVKLVDSRDIVELQLKQSDCELMIRKKEALE Sbjct: 102 VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEALE 142