BLASTX nr result
ID: Glycyrrhiza24_contig00012213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012213 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540025.1| PREDICTED: probable serine/threonine-protein... 56 3e-06 >ref|XP_003540025.1| PREDICTED: probable serine/threonine-protein kinase abkC-like [Glycine max] Length = 619 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +2 Query: 107 MSRLLACGNVRRIAHSFHRQNNTGFLEVFYPMGFPYSAY 223 MSRLLACGN+RR S H+ TG LEVFYPMG PYS Y Sbjct: 1 MSRLLACGNIRRFTRSVHK---TGCLEVFYPMGSPYSRY 36