BLASTX nr result
ID: Glycyrrhiza24_contig00012190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012190 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556375.1| PREDICTED: pleckstrin homology domain-contai... 65 7e-09 gb|ACU19124.1| unknown [Glycine max] 65 7e-09 gb|AFK35132.1| unknown [Lotus japonicus] 64 1e-08 ref|NP_001235537.1| uncharacterized protein LOC100500008 [Glycin... 61 8e-08 ref|XP_003590833.1| Pleckstrin homology domain-containing family... 61 1e-07 >ref|XP_003556375.1| PREDICTED: pleckstrin homology domain-containing family A member 8-like [Glycine max] Length = 202 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 146 MEGTVFTPALEGIKHVKSEQGEILTQPFLDAC 241 MEGTVFTPALEGIK VKSEQGEILTQPFLDAC Sbjct: 1 MEGTVFTPALEGIKLVKSEQGEILTQPFLDAC 32 >gb|ACU19124.1| unknown [Glycine max] Length = 202 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 146 MEGTVFTPALEGIKHVKSEQGEILTQPFLDAC 241 MEGTVFTPALEGIK VKSEQGEILTQPFLDAC Sbjct: 1 MEGTVFTPALEGIKLVKSEQGEILTQPFLDAC 32 >gb|AFK35132.1| unknown [Lotus japonicus] Length = 226 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 146 MEGTVFTPALEGIKHVKSEQGEILTQPFLDAC 241 MEGTVF PALEGIKHVKSEQGEIL+QPFLD C Sbjct: 1 MEGTVFAPALEGIKHVKSEQGEILSQPFLDVC 32 >ref|NP_001235537.1| uncharacterized protein LOC100500008 [Glycine max] gi|255628473|gb|ACU14581.1| unknown [Glycine max] Length = 202 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 146 MEGTVFTPALEGIKHVKSEQGEILTQPFLDAC 241 ME TVFTPALEGIK VKSEQGEILTQPFLDAC Sbjct: 1 MEVTVFTPALEGIKLVKSEQGEILTQPFLDAC 32 >ref|XP_003590833.1| Pleckstrin homology domain-containing family A member [Medicago truncatula] gi|355479881|gb|AES61084.1| Pleckstrin homology domain-containing family A member [Medicago truncatula] Length = 185 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 146 MEGTVFTPALEGIKHVKSEQGEILTQPFLDAC 241 MEGTVF P LEG+KH+KSEQGEIL+QPFLD C Sbjct: 1 MEGTVFAPTLEGMKHIKSEQGEILSQPFLDVC 32