BLASTX nr result
ID: Glycyrrhiza24_contig00012147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012147 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237406.1| uncharacterized protein LOC100527276 [Glycin... 65 8e-09 ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycin... 62 4e-08 ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cuc... 62 5e-08 ref|XP_002533999.1| Protein G10, putative [Ricinus communis] gi|... 62 5e-08 emb|CBI26078.3| unnamed protein product [Vitis vinifera] 61 1e-07 >ref|NP_001237406.1| uncharacterized protein LOC100527276 [Glycine max] gi|255631932|gb|ACU16333.1| unknown [Glycine max] Length = 145 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 90 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 1 MPKVKTNRV YPEGWELIEPTLHELQAKMR Sbjct: 1 MPKVKTNRVTYPEGWELIEPTLHELQAKMR 30 >ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycine max] gi|356512435|ref|XP_003524924.1| PREDICTED: protein BUD31 homolog 2-like [Glycine max] gi|255626029|gb|ACU13359.1| unknown [Glycine max] Length = 145 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 90 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 1 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] gi|449511850|ref|XP_004164071.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] Length = 145 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 1 MPK+KTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKIKTNRVKYPEGWELIEPTLRELQAKMR 30 >ref|XP_002533999.1| Protein G10, putative [Ricinus communis] gi|223526001|gb|EEF28380.1| Protein G10, putative [Ricinus communis] Length = 145 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 90 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 1 MPKVKTNRV YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVNYPEGWELIEPTLRELQAKMR 30 >emb|CBI26078.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 1 MPKVKTNRV+YPEGWELIEPTL ELQ KMR Sbjct: 33 MPKVKTNRVKYPEGWELIEPTLRELQGKMR 62