BLASTX nr result
ID: Glycyrrhiza24_contig00012072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00012072 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S... 76 3e-12 gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum] 76 3e-12 gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus... 76 3e-12 gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus x domes... 76 3e-12 gb|AFK49579.1| unknown [Lotus japonicus] 76 3e-12 >ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus] gi|449532052|ref|XP_004172998.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus] Length = 156 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 93 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 122 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum] Length = 156 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 93 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 122 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus avium] Length = 156 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 93 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 122 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus x domestica] Length = 156 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 93 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 122 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152 >gb|AFK49579.1| unknown [Lotus japonicus] Length = 155 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 93 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK Sbjct: 122 PNAECGAGTFMANHFDRHYCGKCGLTYVYQK 152