BLASTX nr result
ID: Glycyrrhiza24_contig00011947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00011947 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 2e-10 ref|XP_003608892.1| Speckle-type POZ protein [Medicago truncatul... 69 5e-10 ref|XP_003608891.1| Speckle-type POZ protein [Medicago truncatul... 69 5e-10 ref|XP_003525529.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 4e-09 ref|XP_003523120.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 4e-09 >ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Glycine max] Length = 346 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/54 (62%), Positives = 44/54 (81%) Frame = -3 Query: 314 RQIQMKIEEKNKEDDERWKLLVRKVASAKAMSSLSLPKRNRDEEIT*TRGTIDN 153 RQ Q++++++ ++DD +WKLL RKVASAK MSSLSLPKR RDEE TR T+DN Sbjct: 287 RQFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEE---TRVTMDN 337 >ref|XP_003608892.1| Speckle-type POZ protein [Medicago truncatula] gi|355509947|gb|AES91089.1| Speckle-type POZ protein [Medicago truncatula] Length = 292 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -3 Query: 314 RQIQMKIEEKNKEDDERWKLLVRKVASAKAMSSLSLPKRNRDEEIT*TRGTIDN 153 RQ Q+++E++ ++DD +WKLL RKVASAK M SLSLPKR RDEE+ R TIDN Sbjct: 218 RQFQLRMEQEKRKDDPKWKLLARKVASAKVMFSLSLPKRKRDEEM---RVTIDN 268 >ref|XP_003608891.1| Speckle-type POZ protein [Medicago truncatula] gi|355509946|gb|AES91088.1| Speckle-type POZ protein [Medicago truncatula] Length = 362 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -3 Query: 314 RQIQMKIEEKNKEDDERWKLLVRKVASAKAMSSLSLPKRNRDEEIT*TRGTIDN 153 RQ Q+++E++ ++DD +WKLL RKVASAK M SLSLPKR RDEE+ R TIDN Sbjct: 288 RQFQLRMEQEKRKDDPKWKLLARKVASAKVMFSLSLPKRKRDEEM---RVTIDN 338 >ref|XP_003525529.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Glycine max] Length = 286 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -3 Query: 311 QIQMKIEEKNKEDDERWKLLVRKVASAKAMSSLSLPKRNRDEEIT*TRGTIDN 153 Q Q++++++ ++DD +WKLL RKVASAK MSSLSLPKR RDEE TR I+N Sbjct: 228 QFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEE---TRVNINN 277 >ref|XP_003523120.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Glycine max] Length = 327 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -3 Query: 314 RQIQMKIEEKNKEDDERWKLLVRKVASAKAMSSLSLPKRNRDE 186 RQI++K+E++N +DD RWKLLVRKVASAKA+SSL+LPKR D+ Sbjct: 284 RQIRLKMEQENMKDDARWKLLVRKVASAKALSSLALPKRKLDQ 326