BLASTX nr result
ID: Glycyrrhiza24_contig00011862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00011862 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329315.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002329315.1| predicted protein [Populus trichocarpa] gi|222870769|gb|EEF07900.1| predicted protein [Populus trichocarpa] Length = 65 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 123 ISLCKLVVTLKSKIRSLKNKKPYDKVEKSESMRMEIR 233 + L LV+ LKSKIRSLK KKPYDK+EKS+SMR+EIR Sbjct: 4 MGLGSLVMNLKSKIRSLKMKKPYDKIEKSDSMRVEIR 40