BLASTX nr result
ID: Glycyrrhiza24_contig00011708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00011708 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624001.1| hypothetical protein MTR_7g078120 [Medicago ... 54 1e-05 >ref|XP_003624001.1| hypothetical protein MTR_7g078120 [Medicago truncatula] gi|355499016|gb|AES80219.1| hypothetical protein MTR_7g078120 [Medicago truncatula] Length = 661 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = -2 Query: 341 EFVPLRNVFGHQTQKSCRFTLLSPKKPQ----TKGR*LANAIR 225 EF PL+ FGHQT KS FTLLSPKKPQ TKGR L NA++ Sbjct: 557 EFTPLKGSFGHQTDKSNSFTLLSPKKPQPTPHTKGRQLVNALK 599