BLASTX nr result
ID: Glycyrrhiza24_contig00010908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00010908 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524972.1| PREDICTED: uncharacterized protein LOC100500... 70 1e-10 gb|AAM19355.1|AF369888_1 UOS1 [Pisum sativum] 69 3e-10 ref|NP_001242339.1| uncharacterized protein LOC100815475 [Glycin... 69 4e-10 gb|AFK37074.1| unknown [Lotus japonicus] 69 5e-10 ref|XP_003629827.1| UOS1 [Medicago truncatula] gi|355523849|gb|A... 67 2e-09 >ref|XP_003524972.1| PREDICTED: uncharacterized protein LOC100500578 [Glycine max] Length = 601 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 470 VDPANPPPEKDYDTYFKNLKEGITGKELLQQDPMPV 363 VDPANPPPEKDYD YFKNLKEGITGKE LQQ+P+ V Sbjct: 566 VDPANPPPEKDYDVYFKNLKEGITGKEALQQNPVSV 601 >gb|AAM19355.1|AF369888_1 UOS1 [Pisum sativum] Length = 620 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 470 VDPANPPPEKDYDTYFKNLKEGITGKELLQQDPMPV 363 VDP NPPPEKDYD YFK+LKEGITGKE LQQ+P+PV Sbjct: 585 VDPENPPPEKDYDIYFKSLKEGITGKEALQQNPIPV 620 >ref|NP_001242339.1| uncharacterized protein LOC100815475 [Glycine max] gi|255642372|gb|ACU21450.1| unknown [Glycine max] Length = 600 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 470 VDPANPPPEKDYDTYFKNLKEGITGKELLQQDPMPV 363 VDP NPPPEKDYD YFKNLKEGITGKE LQQ+P+ V Sbjct: 565 VDPTNPPPEKDYDVYFKNLKEGITGKEALQQNPVSV 600 >gb|AFK37074.1| unknown [Lotus japonicus] Length = 192 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -2 Query: 470 VDPANPPPEKDYDTYFKNLKEGITGKELLQQDPMPV 363 +DPANPPPEKDY+ YFK+LKEGITGKE LQQ+P+PV Sbjct: 157 LDPANPPPEKDYNVYFKDLKEGITGKEALQQNPVPV 192 >ref|XP_003629827.1| UOS1 [Medicago truncatula] gi|355523849|gb|AET04303.1| UOS1 [Medicago truncatula] Length = 478 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -2 Query: 470 VDPANPPPEKDYDTYFKNLKEGITGKELLQQDPMPV 363 VDP NPP EKDYD YFKNLKEGITGKE LQQ P PV Sbjct: 443 VDPENPPSEKDYDIYFKNLKEGITGKEALQQSPTPV 478