BLASTX nr result
ID: Glycyrrhiza24_contig00010418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00010418 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608165.1| Isoflavonoid malonyl transferase [Medicago t... 88 8e-16 gb|ABY91221.1| isoflavonoid malonyl transferase 3 [Medicago trun... 88 8e-16 ref|XP_003621462.1| Isoflavonoid malonyl transferase [Medicago t... 87 1e-15 gb|ABY91220.1| isoflavonoid malonyl transferase 1 [Medicago trun... 87 1e-15 ref|XP_003552581.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 85 7e-15 >ref|XP_003608165.1| Isoflavonoid malonyl transferase [Medicago truncatula] gi|355509220|gb|AES90362.1| Isoflavonoid malonyl transferase [Medicago truncatula] Length = 111 Score = 87.8 bits (216), Expect = 8e-16 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -2 Query: 167 CKVTPPPSATHTSLPLTFFDLLWLKLHPVERVFYYTLPTPQSHPSFFFNQVVPKL 3 CKV+P S+T SLPLTFFD +WL+ HPVER+F+YTLP+ SHP+FFF +VPKL Sbjct: 14 CKVSPSSSSTQLSLPLTFFDYIWLRFHPVERIFFYTLPSSHSHPTFFFENLVPKL 68 >gb|ABY91221.1| isoflavonoid malonyl transferase 3 [Medicago truncatula] Length = 483 Score = 87.8 bits (216), Expect = 8e-16 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -2 Query: 167 CKVTPPPSATHTSLPLTFFDLLWLKLHPVERVFYYTLPTPQSHPSFFFNQVVPKL 3 CKV+P S+T SLPLTFFD +WL+ HPVER+F+YTLP+ SHP+FFF +VPKL Sbjct: 14 CKVSPSSSSTQLSLPLTFFDYIWLRFHPVERIFFYTLPSSHSHPTFFFENLVPKL 68 >ref|XP_003621462.1| Isoflavonoid malonyl transferase [Medicago truncatula] gi|355496477|gb|AES77680.1| Isoflavonoid malonyl transferase [Medicago truncatula] Length = 472 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = -2 Query: 164 KVTPPPSATHTSLPLTFFDLLWLKLHPVERVFYYTLPTPQSHPSFFFNQVVPKL 3 KV PP S TS+PLTFFD+ WL+ HPVERVF+YTLP QSHPSFFF +VP L Sbjct: 16 KVVPPSSTKTTSIPLTFFDIFWLRFHPVERVFFYTLPNSQSHPSFFFQTIVPNL 69 >gb|ABY91220.1| isoflavonoid malonyl transferase 1 [Medicago truncatula] Length = 472 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = -2 Query: 164 KVTPPPSATHTSLPLTFFDLLWLKLHPVERVFYYTLPTPQSHPSFFFNQVVPKL 3 KV PP S TS+PLTFFD+ WL+ HPVERVF+YTLP QSHPSFFF +VP L Sbjct: 16 KVVPPSSTKTTSIPLTFFDIFWLRFHPVERVFFYTLPNSQSHPSFFFQTIVPNL 69 >ref|XP_003552581.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Glycine max] Length = 477 Score = 84.7 bits (208), Expect = 7e-15 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -2 Query: 152 PPSATHTSLPLTFFDLLWLKLHPVERVFYYTLPTPQSHPSFFFNQVVPKL 3 PPSAT TSL L FFDL WL+ HPVER+F+YTLPTPQS PS F++++VPKL Sbjct: 18 PPSATATSLSLKFFDLFWLRFHPVERIFFYTLPTPQSDPSIFYSKIVPKL 67