BLASTX nr result
ID: Glycyrrhiza24_contig00010270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00010270 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553517.1| PREDICTED: receptor-like serine/threonine-pr... 67 2e-09 >ref|XP_003553517.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Glycine max] Length = 786 Score = 66.6 bits (161), Expect = 2e-09 Identities = 41/92 (44%), Positives = 47/92 (51%) Frame = +2 Query: 116 MTSGAFFAGIPPVAARXXXXXXXXXXXDDALRQFSVPPRRMPASVIFLVTLLNXXXXXXX 295 MT+G AGI P A DDALR V RMP SV+FL+ LLN Sbjct: 1 MTAGGCSAGISPPAGHSSKPLLSP---DDALRWCRVRRERMPVSVVFLLALLNLLFSCQV 57 Query: 296 XXXXXXXXXASLDQAKSWLVRPSSGPSPAPVP 391 AS ++AK WLV+PSSGPS APVP Sbjct: 58 KSISLSVSFASSERAKMWLVKPSSGPSSAPVP 89