BLASTX nr result
ID: Glycyrrhiza24_contig00010100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00010100 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602231.1| Histone-lysine N-methyltransferase ATX5 [Med... 140 1e-31 ref|XP_002513549.1| trithorax, putative [Ricinus communis] gi|22... 139 2e-31 ref|XP_002321418.1| SET domain protein [Populus trichocarpa] gi|... 137 1e-30 ref|XP_002864242.1| hypothetical protein ARALYDRAFT_918421 [Arab... 135 3e-30 ref|XP_002318412.1| SET domain protein [Populus trichocarpa] gi|... 135 3e-30 >ref|XP_003602231.1| Histone-lysine N-methyltransferase ATX5 [Medicago truncatula] gi|355491279|gb|AES72482.1| Histone-lysine N-methyltransferase ATX5 [Medicago truncatula] Length = 1053 Score = 140 bits (352), Expect = 1e-31 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -1 Query: 459 HSCMPNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNC 280 HSCMPNCYARIMSVGDDESRI LIAKTNVSAGDELTYDYLFDPDEPDEFKVPC+CK+PNC Sbjct: 989 HSCMPNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPDEFKVPCMCKAPNC 1048 Query: 279 RKFMN 265 RKFMN Sbjct: 1049 RKFMN 1053 >ref|XP_002513549.1| trithorax, putative [Ricinus communis] gi|223547457|gb|EEF48952.1| trithorax, putative [Ricinus communis] Length = 1018 Score = 139 bits (350), Expect = 2e-31 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -1 Query: 459 HSCMPNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNC 280 HSCMPNCYARIMSVGDDESRI LIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCK+PNC Sbjct: 954 HSCMPNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKAPNC 1013 Query: 279 RKFMN 265 R+FMN Sbjct: 1014 RQFMN 1018 >ref|XP_002321418.1| SET domain protein [Populus trichocarpa] gi|222868414|gb|EEF05545.1| SET domain protein [Populus trichocarpa] Length = 1070 Score = 137 bits (344), Expect = 1e-30 Identities = 61/65 (93%), Positives = 63/65 (96%) Frame = -1 Query: 459 HSCMPNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNC 280 HSCMPNCYARIMSVGD+ESRI LIAKTNV AGDELTYDYLFDPDEPDEFKVPCLCK+PNC Sbjct: 1006 HSCMPNCYARIMSVGDNESRIVLIAKTNVPAGDELTYDYLFDPDEPDEFKVPCLCKAPNC 1065 Query: 279 RKFMN 265 RKFMN Sbjct: 1066 RKFMN 1070 >ref|XP_002864242.1| hypothetical protein ARALYDRAFT_918421 [Arabidopsis lyrata subsp. lyrata] gi|297310077|gb|EFH40501.1| hypothetical protein ARALYDRAFT_918421 [Arabidopsis lyrata subsp. lyrata] Length = 1049 Score = 135 bits (341), Expect = 3e-30 Identities = 60/65 (92%), Positives = 63/65 (96%) Frame = -1 Query: 459 HSCMPNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNC 280 HSCMPNCYARIMSVGDDESRI LIAKT V++G+ELTYDYLFDPDEPDEFKVPCLCKSPNC Sbjct: 985 HSCMPNCYARIMSVGDDESRIVLIAKTTVASGEELTYDYLFDPDEPDEFKVPCLCKSPNC 1044 Query: 279 RKFMN 265 RKFMN Sbjct: 1045 RKFMN 1049 >ref|XP_002318412.1| SET domain protein [Populus trichocarpa] gi|222859085|gb|EEE96632.1| SET domain protein [Populus trichocarpa] Length = 1078 Score = 135 bits (341), Expect = 3e-30 Identities = 60/65 (92%), Positives = 64/65 (98%) Frame = -1 Query: 459 HSCMPNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNC 280 HSCMPNCYARIMSVGD+ESRI LIAKTNVSAGDELTYDYLFDP+EPDEFKVPCLCK+PNC Sbjct: 1014 HSCMPNCYARIMSVGDNESRIVLIAKTNVSAGDELTYDYLFDPNEPDEFKVPCLCKAPNC 1073 Query: 279 RKFMN 265 RK+MN Sbjct: 1074 RKYMN 1078