BLASTX nr result
ID: Glycyrrhiza24_contig00009878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00009878 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173402.1| PREDICTED: elongation factor 2-like, partial... 65 8e-09 ref|XP_004162152.1| PREDICTED: elongation factor 2-like, partial... 65 8e-09 ref|XP_004145803.1| PREDICTED: elongation factor 2-like [Cucumis... 65 8e-09 ref|XP_004143226.1| PREDICTED: elongation factor 2-like [Cucumis... 65 8e-09 ref|XP_004143180.1| PREDICTED: elongation factor 2-like [Cucumis... 65 8e-09 >ref|XP_004173402.1| PREDICTED: elongation factor 2-like, partial [Cucumis sativus] Length = 379 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 166 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 255 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH Sbjct: 1 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 30 >ref|XP_004162152.1| PREDICTED: elongation factor 2-like, partial [Cucumis sativus] Length = 445 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 166 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 255 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH Sbjct: 1 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 30 >ref|XP_004145803.1| PREDICTED: elongation factor 2-like [Cucumis sativus] Length = 793 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 166 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 255 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH Sbjct: 1 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 30 >ref|XP_004143226.1| PREDICTED: elongation factor 2-like [Cucumis sativus] Length = 430 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 166 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 255 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH Sbjct: 1 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 30 >ref|XP_004143180.1| PREDICTED: elongation factor 2-like [Cucumis sativus] Length = 843 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 166 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 255 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH Sbjct: 1 MVKFTAEELRRIMDYKHNIRNMSVIAHVDH 30