BLASTX nr result
ID: Glycyrrhiza24_contig00009545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00009545 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593492.1| Disease resistance-like protein GS4-5 [Medic... 145 4e-33 ref|XP_003613569.1| Disease resistance-like protein [Medicago tr... 141 5e-32 ref|XP_003620079.1| Resistance protein [Medicago truncatula] gi|... 141 5e-32 ref|XP_003619954.1| Disease resistance-like protein [Medicago tr... 140 1e-31 ref|XP_003620126.1| Disease resistance-like protein [Medicago tr... 138 5e-31 >ref|XP_003593492.1| Disease resistance-like protein GS4-5 [Medicago truncatula] gi|355482540|gb|AES63743.1| Disease resistance-like protein GS4-5 [Medicago truncatula] Length = 895 Score = 145 bits (365), Expect = 4e-33 Identities = 68/88 (77%), Positives = 82/88 (93%) Frame = -2 Query: 266 GIYGIGGMGKSTLARAIYNFIADKFEGLCFLHNMRENSYKHGLEHLQEILLSRTIGLNIK 87 GIYG+GGMGK+TLARA+YNFIA++FE +CFLHN+RENS KHGLEHLQ+ LS+T+GL+IK Sbjct: 228 GIYGLGGMGKTTLARAVYNFIANQFECVCFLHNVRENSAKHGLEHLQKDFLSKTVGLDIK 287 Query: 86 VGDVSEGISIIKQRLHRKKILLVLDDVD 3 +GD SEGI IIKQRLHRKK+LLVLDDV+ Sbjct: 288 LGDSSEGIPIIKQRLHRKKVLLVLDDVN 315 >ref|XP_003613569.1| Disease resistance-like protein [Medicago truncatula] gi|355514904|gb|AES96527.1| Disease resistance-like protein [Medicago truncatula] Length = 1082 Score = 141 bits (356), Expect = 5e-32 Identities = 69/88 (78%), Positives = 81/88 (92%) Frame = -2 Query: 266 GIYGIGGMGKSTLARAIYNFIADKFEGLCFLHNMRENSYKHGLEHLQEILLSRTIGLNIK 87 GI+GIGG+GK+TLARAIYN IAD+FE LCFLH++RENS KHGLEHLQE LLS+TIGL+IK Sbjct: 232 GIHGIGGIGKTTLARAIYNLIADQFECLCFLHDVRENSSKHGLEHLQERLLSKTIGLDIK 291 Query: 86 VGDVSEGISIIKQRLHRKKILLVLDDVD 3 +G VSEGI IIKQRL +KK+LL+LDDVD Sbjct: 292 LGHVSEGIPIIKQRLQQKKVLLILDDVD 319 >ref|XP_003620079.1| Resistance protein [Medicago truncatula] gi|355495094|gb|AES76297.1| Resistance protein [Medicago truncatula] Length = 667 Score = 141 bits (356), Expect = 5e-32 Identities = 66/87 (75%), Positives = 80/87 (91%) Frame = -2 Query: 266 GIYGIGGMGKSTLARAIYNFIADKFEGLCFLHNMRENSYKHGLEHLQEILLSRTIGLNIK 87 GIYG GGMGK+TLARA+YN IAD+F+GLCFLHN+RENS K+GLEHLQE LLS+ + L++K Sbjct: 229 GIYGTGGMGKTTLARAVYNSIADQFDGLCFLHNVRENSAKYGLEHLQEKLLSKLVELDVK 288 Query: 86 VGDVSEGISIIKQRLHRKKILLVLDDV 6 +GDV+EGI IIKQRLHRKK+LL+LDDV Sbjct: 289 LGDVNEGIPIIKQRLHRKKVLLILDDV 315 >ref|XP_003619954.1| Disease resistance-like protein [Medicago truncatula] gi|355494969|gb|AES76172.1| Disease resistance-like protein [Medicago truncatula] Length = 1098 Score = 140 bits (352), Expect = 1e-31 Identities = 66/88 (75%), Positives = 80/88 (90%) Frame = -2 Query: 266 GIYGIGGMGKSTLARAIYNFIADKFEGLCFLHNMRENSYKHGLEHLQEILLSRTIGLNIK 87 G+YG GGMGKSTLA+AIYNF+AD+FEG+CFLHN+RENS + L+HLQE LLS+T+ +NIK Sbjct: 222 GLYGTGGMGKSTLAKAIYNFVADQFEGVCFLHNVRENSAHNNLKHLQEELLSKTVRVNIK 281 Query: 86 VGDVSEGISIIKQRLHRKKILLVLDDVD 3 +GDVSEGI IIK+RL RKKILL+LDDVD Sbjct: 282 LGDVSEGIPIIKERLSRKKILLILDDVD 309 >ref|XP_003620126.1| Disease resistance-like protein [Medicago truncatula] gi|355495141|gb|AES76344.1| Disease resistance-like protein [Medicago truncatula] Length = 1013 Score = 138 bits (347), Expect = 5e-31 Identities = 66/88 (75%), Positives = 79/88 (89%) Frame = -2 Query: 266 GIYGIGGMGKSTLARAIYNFIADKFEGLCFLHNMRENSYKHGLEHLQEILLSRTIGLNIK 87 GIYGIGG+GK+TLARAIYN I DKFE LCFLH++RE+S KHGLEHLQ+ LLS+T+ L+ K Sbjct: 218 GIYGIGGLGKTTLARAIYNMIGDKFECLCFLHDLRESSAKHGLEHLQQKLLSKTVELDTK 277 Query: 86 VGDVSEGISIIKQRLHRKKILLVLDDVD 3 +GDV+EGI IIKQRL RKK+LL+LDDVD Sbjct: 278 LGDVNEGIPIIKQRLGRKKVLLILDDVD 305