BLASTX nr result
ID: Glycyrrhiza24_contig00008962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008962 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548053.1| PREDICTED: NAC domain-containing protein 29-... 129 3e-28 ref|XP_003518189.1| PREDICTED: NAC domain-containing protein 29-... 128 4e-28 gb|ACD39368.1| NAC domain protein, partial [Glycine max] 123 1e-26 ref|XP_003624592.1| NAC domain transcription factor [Medicago tr... 115 5e-24 ref|NP_001236142.1| transcriptional factor NAC11 [Glycine max] g... 113 2e-23 >ref|XP_003548053.1| PREDICTED: NAC domain-containing protein 29-like [Glycine max] Length = 363 Score = 129 bits (324), Expect = 3e-28 Identities = 60/67 (89%), Positives = 64/67 (95%) Frame = +2 Query: 146 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPANSIIADINIYKFAPWELPAKAA 325 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLP +IIA+++IYKF PWELPAKAA Sbjct: 1 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPV-AIIAEVDIYKFDPWELPAKAA 59 Query: 326 FGEKEWY 346 FGEKEWY Sbjct: 60 FGEKEWY 66 >ref|XP_003518189.1| PREDICTED: NAC domain-containing protein 29-like [Glycine max] Length = 354 Score = 128 bits (322), Expect = 4e-28 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +2 Query: 146 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPANSIIADINIYKFAPWELPAKAA 325 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLP SIIA+++IYKF PWELPAKA Sbjct: 1 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPV-SIIAEVDIYKFDPWELPAKAE 59 Query: 326 FGEKEWY 346 FGEKEWY Sbjct: 60 FGEKEWY 66 >gb|ACD39368.1| NAC domain protein, partial [Glycine max] Length = 129 Score = 123 bits (309), Expect = 1e-26 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = +2 Query: 146 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPANSIIADINIYKFAPWELPAKAA 325 MGTPQSNNLPPGFRFHPTD LILHYLRKKVASIPLP +IIA+++IYKF PWELPAKAA Sbjct: 1 MGTPQSNNLPPGFRFHPTDVFLILHYLRKKVASIPLPV-AIIAEVDIYKFDPWELPAKAA 59 Query: 326 FGEKEWY 346 FGEKEWY Sbjct: 60 FGEKEWY 66 >ref|XP_003624592.1| NAC domain transcription factor [Medicago truncatula] gi|355499607|gb|AES80810.1| NAC domain transcription factor [Medicago truncatula] Length = 340 Score = 115 bits (287), Expect = 5e-24 Identities = 54/67 (80%), Positives = 61/67 (91%) Frame = +2 Query: 146 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPANSIIADINIYKFAPWELPAKAA 325 MGTPQ+N LPPGFRFHPTD ELILHYLRKK+ASIPLP SIIA+++IYK PW+LPAKA+ Sbjct: 1 MGTPQTN-LPPGFRFHPTDAELILHYLRKKIASIPLPV-SIIAEVDIYKLDPWDLPAKAS 58 Query: 326 FGEKEWY 346 FGEKEWY Sbjct: 59 FGEKEWY 65 >ref|NP_001236142.1| transcriptional factor NAC11 [Glycine max] gi|184097798|gb|ACC66315.1| transcriptional factor NAC11 [Glycine max] Length = 351 Score = 113 bits (282), Expect = 2e-23 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = +2 Query: 146 MGTPQSNNLPPGFRFHPTDEELILHYLRKKVASIPLPANSIIADINIYKFAPWELPAKAA 325 MG P+SN LPPGFRFHPTDEELILHYL KKVASIPLP SIIA+++IYK PW+LPAKA Sbjct: 1 MGNPESN-LPPGFRFHPTDEELILHYLSKKVASIPLPV-SIIAEVDIYKLDPWDLPAKAT 58 Query: 326 FGEKEWY 346 FGEKEWY Sbjct: 59 FGEKEWY 65