BLASTX nr result
ID: Glycyrrhiza24_contig00008939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008939 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV36700.1| amino acid transporter protein [Glycine max] gi|4... 44 1e-09 ref|XP_003538492.1| PREDICTED: probable sodium-coupled neutral a... 44 1e-09 ref|XP_003552164.1| PREDICTED: putative sodium-coupled neutral a... 44 1e-09 ref|XP_003601018.1| Sodium-coupled neutral amino acid transporte... 36 9e-06 ref|XP_003601017.1| Sodium-coupled neutral amino acid transporte... 36 9e-06 >gb|AFV36700.1| amino acid transporter protein [Glycine max] gi|409691607|gb|AFV36705.1| amino acid transporter protein [Glycine max] gi|409691624|gb|AFV36716.1| amino acid transporter protein [Glycine max] Length = 436 Score = 44.3 bits (103), Expect(3) = 1e-09 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = -2 Query: 162 FLVLYGVFENLSESLKYSFVVSTFLAEKNKKKKTFLAVVFVGICCGLAIVAVVQ 1 F++L V ESLKYS VST LA V FVGICCGLAI A+VQ Sbjct: 160 FVMLPLVLYKRVESLKYSSAVSTLLA-----------VAFVGICCGLAITALVQ 202 Score = 32.0 bits (71), Expect(3) = 1e-09 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 284 WNSWEFALFFTLVFVM 237 WNS EFAL FTLVFVM Sbjct: 147 WNSREFALLFTLVFVM 162 Score = 30.8 bits (68), Expect(3) = 1e-09 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 319 GEVHLGIMQRWFG 281 GEVHLGI+Q+WFG Sbjct: 131 GEVHLGILQQWFG 143 >ref|XP_003538492.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Glycine max] Length = 436 Score = 44.3 bits (103), Expect(3) = 1e-09 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = -2 Query: 162 FLVLYGVFENLSESLKYSFVVSTFLAEKNKKKKTFLAVVFVGICCGLAIVAVVQ 1 F++L V ESLKYS VST LA V FVGICCGLAI A+VQ Sbjct: 160 FVMLPLVLYKRVESLKYSSAVSTLLA-----------VAFVGICCGLAITALVQ 202 Score = 32.0 bits (71), Expect(3) = 1e-09 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 284 WNSWEFALFFTLVFVM 237 WNS EFAL FTLVFVM Sbjct: 147 WNSREFALLFTLVFVM 162 Score = 30.8 bits (68), Expect(3) = 1e-09 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 319 GEVHLGIMQRWFG 281 GEVHLGI+Q+WFG Sbjct: 131 GEVHLGILQQWFG 143 >ref|XP_003552164.1| PREDICTED: putative sodium-coupled neutral amino acid transporter 7-like [Glycine max] Length = 250 Score = 44.3 bits (103), Expect(3) = 1e-09 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = -2 Query: 162 FLVLYGVFENLSESLKYSFVVSTFLAEKNKKKKTFLAVVFVGICCGLAIVAVVQ 1 F++L V ESLKYS VST LA V FVGICCGLAI A+VQ Sbjct: 160 FVMLPLVLYKRVESLKYSSAVSTLLA-----------VAFVGICCGLAITALVQ 202 Score = 32.0 bits (71), Expect(3) = 1e-09 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 284 WNSWEFALFFTLVFVM 237 WNS EFAL FTLVFVM Sbjct: 147 WNSREFALLFTLVFVM 162 Score = 30.8 bits (68), Expect(3) = 1e-09 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 319 GEVHLGIMQRWFG 281 GEVHLGI+Q+WFG Sbjct: 131 GEVHLGILQQWFG 143 >ref|XP_003601018.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355490066|gb|AES71269.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 586 Score = 36.2 bits (82), Expect(3) = 9e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 126 ESLKYSFVVSTFLAEKNKKKKTFLAVVFVGICCGLAIVAVVQ 1 ESLKYS +ST LA V FV IC GLAIVA+VQ Sbjct: 322 ESLKYSSGISTLLA-----------VAFVTICSGLAIVALVQ 352 Score = 30.0 bits (66), Expect(3) = 9e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -1 Query: 319 GEVHLGIMQRWFG 281 GEVHLG++Q+WFG Sbjct: 281 GEVHLGLLQQWFG 293 Score = 26.9 bits (58), Expect(3) = 9e-06 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 284 WNSWEFALFFTLVFVM 237 WNS E ALF TLV VM Sbjct: 297 WNSREVALFITLVLVM 312 >ref|XP_003601017.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355490065|gb|AES71268.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 577 Score = 36.2 bits (82), Expect(3) = 9e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -2 Query: 126 ESLKYSFVVSTFLAEKNKKKKTFLAVVFVGICCGLAIVAVVQ 1 ESLKYS +ST LA V FV IC GLAIVA+VQ Sbjct: 313 ESLKYSSGISTLLA-----------VAFVTICSGLAIVALVQ 343 Score = 30.0 bits (66), Expect(3) = 9e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -1 Query: 319 GEVHLGIMQRWFG 281 GEVHLG++Q+WFG Sbjct: 272 GEVHLGLLQQWFG 284 Score = 26.9 bits (58), Expect(3) = 9e-06 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 284 WNSWEFALFFTLVFVM 237 WNS E ALF TLV VM Sbjct: 288 WNSREVALFITLVLVM 303