BLASTX nr result
ID: Glycyrrhiza24_contig00008787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008787 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511833.1| Remorin, putative [Ricinus communis] gi|2235... 61 1e-07 ref|XP_002320784.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 gb|ABK95953.1| unknown [Populus trichocarpa] 60 1e-07 ref|XP_002448229.1| hypothetical protein SORBIDRAFT_06g023630 [S... 59 3e-07 ref|NP_001159012.1| remorin [Zea mays] gi|194708138|gb|ACF88153.... 59 3e-07 >ref|XP_002511833.1| Remorin, putative [Ricinus communis] gi|223549013|gb|EEF50502.1| Remorin, putative [Ricinus communis] Length = 188 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 393 EAKRGEEVLKAEEMAARFRATGTTPKKLLGCF 298 EA+RGEEVLKAEEMAA++RATG TPKKLLGCF Sbjct: 157 EAQRGEEVLKAEEMAAKYRATGQTPKKLLGCF 188 >ref|XP_002320784.1| predicted protein [Populus trichocarpa] gi|222861557|gb|EEE99099.1| predicted protein [Populus trichocarpa] Length = 193 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 393 EAKRGEEVLKAEEMAARFRATGTTPKKLLGCF 298 EAKRGEE LKAEEMAA++RATG TPKKLLGCF Sbjct: 162 EAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF 193 >gb|ABK95953.1| unknown [Populus trichocarpa] Length = 66 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 393 EAKRGEEVLKAEEMAARFRATGTTPKKLLGCF 298 EAKRGEE LKAEEMAA++RATG TPKKLLGCF Sbjct: 35 EAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF 66 >ref|XP_002448229.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor] gi|241939412|gb|EES12557.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor] Length = 212 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 393 EAKRGEEVLKAEEMAARFRATGTTPKKLLGCF 298 EAKRGEEVLKAEEMAA++RATG PKKL+GCF Sbjct: 179 EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCF 210 >ref|NP_001159012.1| remorin [Zea mays] gi|194708138|gb|ACF88153.1| unknown [Zea mays] gi|195628632|gb|ACG36146.1| remorin [Zea mays] gi|414586120|tpg|DAA36691.1| TPA: Remorin isoform 1 [Zea mays] gi|414586121|tpg|DAA36692.1| TPA: Remorin isoform 2 [Zea mays] Length = 199 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 393 EAKRGEEVLKAEEMAARFRATGTTPKKLLGCF 298 EAKRGEEVLKAEEMAA++RATG PKKL+GCF Sbjct: 166 EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCF 197