BLASTX nr result
ID: Glycyrrhiza24_contig00008647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008647 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002314922.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_002512034.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778... 57 1e-06 >ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|222852165|gb|EEE89712.1| predicted protein [Populus trichocarpa] Length = 116 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 368 ASKTDIRQQVEAEEKFKLISRMKEKFLFTSCH 273 ASKTDIR+QVEAEEKFKLISRMKEKFL TSC+ Sbjct: 85 ASKTDIRRQVEAEEKFKLISRMKEKFLSTSCY 116 >ref|XP_002314922.1| predicted protein [Populus trichocarpa] gi|222863962|gb|EEF01093.1| predicted protein [Populus trichocarpa] Length = 724 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 368 ASKTDIRQQVEAEEKFKLISRMKEKFLFTSCH 273 ASKTDIRQQVEAEEKFKLISRMKEKFL TS H Sbjct: 693 ASKTDIRQQVEAEEKFKLISRMKEKFLSTSYH 724 >ref|XP_002512034.1| conserved hypothetical protein [Ricinus communis] gi|223549214|gb|EEF50703.1| conserved hypothetical protein [Ricinus communis] Length = 632 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 368 ASKTDIRQQVEAEEKFKLISRMKEKFLFTSCH 273 AS+TDIRQQVEAEEKFKLISRMK+KFL TSC+ Sbjct: 601 ASRTDIRQQVEAEEKFKLISRMKQKFLSTSCY 632 >ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778452 [Glycine max] Length = 555 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 368 ASKTDIRQQVEAEEKFKLISRMKEKFLFTSCH 273 ASKTD+R QVEAEEKFKLISR+KEKF TSCH Sbjct: 524 ASKTDVRAQVEAEEKFKLISRLKEKFGMTSCH 555