BLASTX nr result
ID: Glycyrrhiza24_contig00008609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008609 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554053.1| PREDICTED: xylosyltransferase 1-like [Glycin... 56 3e-06 ref|XP_002525678.1| acetylglucosaminyltransferase, putative [Ric... 55 8e-06 >ref|XP_003554053.1| PREDICTED: xylosyltransferase 1-like [Glycine max] Length = 399 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +3 Query: 9 LKSENFGVLNPGPASRKLKILLSNVLSRKNFHKQQCR 119 L++EN+GVL PGP+SR+LK LL+ +LS K FHKQQCR Sbjct: 363 LRTENYGVLRPGPSSRRLKNLLTKLLSDKFFHKQQCR 399 >ref|XP_002525678.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223534978|gb|EEF36661.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 271 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +3 Query: 9 LKSENFGVLNPGPASRKLKILLSNVLSRKNFHKQQCR 119 +K EN+GVL PGP SR+LK LL+ ++S KNF K+QCR Sbjct: 235 IKGENYGVLRPGPGSRRLKSLLTKLISEKNFSKRQCR 271