BLASTX nr result
ID: Glycyrrhiza24_contig00008499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008499 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518188.1| PREDICTED: nucleoside-triphosphatase-like [G... 57 2e-06 >ref|XP_003518188.1| PREDICTED: nucleoside-triphosphatase-like [Glycine max] Length = 472 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 116 MLKRPGHKPPVPAPESFSDKIYQLRGAFLMVALPLLVV 3 MLKR G +PP P PES +DKIY LRGAFLMVA+PLL+V Sbjct: 1 MLKRSG-RPPPPTPESLTDKIYHLRGAFLMVAVPLLLV 37