BLASTX nr result
ID: Glycyrrhiza24_contig00008291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008291 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containi... 174 7e-42 ref|XP_003607763.1| Pentatricopeptide repeat-containing protein ... 97 1e-18 ref|XP_004144815.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_002512497.1| pentatricopeptide repeat-containing protein,... 66 3e-09 ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 >ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] Length = 634 Score = 174 bits (441), Expect = 7e-42 Identities = 83/110 (75%), Positives = 93/110 (84%) Frame = -2 Query: 334 NPQNLATLLQGHLPRSHLLQSHARVFQVGAHQDNLIATRLIGQYPSRVALRVFHQLQNPN 155 +P NLATLLQG++PRSHLLQ HAR+F +GAHQDNLIATRLIG YPSR ALRVFH LQNPN Sbjct: 35 DPTNLATLLQGNIPRSHLLQIHARIFYLGAHQDNLIATRLIGHYPSRAALRVFHHLQNPN 94 Query: 154 IFPFNAIIRVLAHEGHFFQVFSLFHCLKQRPLIPNDLTFSFLLKACLKCK 5 IFPFNAIIRVLA +GHFF S+F+ LK+R L PNDLTFSFL K C + K Sbjct: 95 IFPFNAIIRVLAQDGHFFHALSVFNYLKRRSLSPNDLTFSFLFKPCFRTK 144 >ref|XP_003607763.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508818|gb|AES89960.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 871 Score = 97.4 bits (241), Expect = 1e-18 Identities = 49/74 (66%), Positives = 54/74 (72%) Frame = -2 Query: 316 TLLQGHLPRSHLLQSHARVFQVGAHQDNLIATRLIGQYPSRVALRVFHQLQNPNIFPFNA 137 T LQGHL HLLQ HA +FQ GAHQ NLIATRLIG Y S++ L VFHQL NPN FPFN Sbjct: 728 TSLQGHLSLPHLLQIHAHIFQFGAHQHNLIATRLIGHYISQIDLCVFHQLHNPNNFPFND 787 Query: 136 IIRVLAHEGHFFQV 95 IIR LA + +F V Sbjct: 788 IIRFLAQKAYFLFV 801 >ref|XP_004144815.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Cucumis sativus] gi|449490933|ref|XP_004158752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Cucumis sativus] Length = 484 Score = 72.8 bits (177), Expect = 3e-11 Identities = 43/108 (39%), Positives = 58/108 (53%), Gaps = 4/108 (3%) Frame = -2 Query: 328 QNLATLLQGHLPRSHLLQSHARVFQVGAHQDNLIATRLIGQYPS--RVAL--RVFHQLQN 161 + + LL GH R+HL Q HA + G HQ N I I S R+A R+F Q N Sbjct: 10 RRILRLLHGHKSRTHLTQIHAHFLRHGLHQSNQILAHFISVCASFNRIAYADRLFSQSHN 69 Query: 160 PNIFPFNAIIRVLAHEGHFFQVFSLFHCLKQRPLIPNDLTFSFLLKAC 17 PNIF FN+II+ + F Q LF +K ++P+ TF+ LLK+C Sbjct: 70 PNIFLFNSIIKAHSLSVPFHQSLLLFSSMKNHRIVPDQYTFAPLLKSC 117 >ref|XP_002512497.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548458|gb|EEF49949.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 459 Score = 66.2 bits (160), Expect = 3e-09 Identities = 42/108 (38%), Positives = 57/108 (52%), Gaps = 4/108 (3%) Frame = -2 Query: 328 QNLATLLQGHLPRSHLLQSHARVFQVGAHQDNLIATRLIGQYPSR----VALRVFHQLQN 161 + + LL GH R+ L Q HA + G Q N I I S A RVF Q N Sbjct: 168 RKILKLLHGHNTRTQLRQIHAHFLRHGLDQLNHILAHFISVCGSENKMPYANRVFLQSVN 227 Query: 160 PNIFPFNAIIRVLAHEGHFFQVFSLFHCLKQRPLIPNDLTFSFLLKAC 17 PNI PFNA+++ + G F + S F +K+R + P++ TF+ LLKAC Sbjct: 228 PNILPFNAMVKGYSLCGPFEESLSFFSSMKRRGIWPDEYTFAPLLKAC 275 >ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Glycine max] Length = 628 Score = 63.9 bits (154), Expect = 1e-08 Identities = 38/112 (33%), Positives = 54/112 (48%), Gaps = 4/112 (3%) Frame = -2 Query: 340 PNNPQNLATLLQGHLPRSHLLQSHARVFQVGAHQDNLIATRLIGQYPS----RVALRVFH 173 P + NLA L+ HLLQ HA + + G H ++ +L Y S ++ +FH Sbjct: 20 PVDKDNLALLIDNSKSTHHLLQIHAALLRRGLHHHPILNFKLQRSYASLGHLHHSVTLFH 79 Query: 172 QLQNPNIFPFNAIIRVLAHEGHFFQVFSLFHCLKQRPLIPNDLTFSFLLKAC 17 + NPN+F + II AH F S + + P+ PN T S LLKAC Sbjct: 80 RTPNPNVFLWTHIINAHAHFDLFHHALSYYSQMLTHPIQPNAFTLSSLLKAC 131