BLASTX nr result
ID: Glycyrrhiza24_contig00008268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008268 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK28847.1| Ser/Thr protein kinase [Medicago truncatula] 69 4e-10 ref|XP_003624638.1| Ser/Thr protein kinase [Medicago truncatula]... 69 4e-10 gb|ABN05783.1| Protein kinase [Medicago truncatula] 69 4e-10 ref|XP_003624361.1| Ser/Thr protein kinase [Medicago truncatula]... 62 5e-08 ref|XP_003624357.1| Ser/Thr protein kinase [Medicago truncatula]... 62 5e-08 >gb|ABK28847.1| Ser/Thr protein kinase [Medicago truncatula] Length = 418 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -1 Query: 306 PSMSKVIEMLLGPLQSVPYPPKPALYSLERPSLQISYV 193 PSMSKVIEML GPL SVPYPPKP LYS ERPSLQISYV Sbjct: 376 PSMSKVIEMLQGPLGSVPYPPKPFLYSPERPSLQISYV 413 >ref|XP_003624638.1| Ser/Thr protein kinase [Medicago truncatula] gi|355499653|gb|AES80856.1| Ser/Thr protein kinase [Medicago truncatula] Length = 469 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -1 Query: 306 PSMSKVIEMLLGPLQSVPYPPKPALYSLERPSLQISYV 193 PSMSKVIEML GPL SVPYPPKP LYS ERPSLQISYV Sbjct: 427 PSMSKVIEMLQGPLGSVPYPPKPFLYSPERPSLQISYV 464 >gb|ABN05783.1| Protein kinase [Medicago truncatula] Length = 188 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -1 Query: 306 PSMSKVIEMLLGPLQSVPYPPKPALYSLERPSLQISYV 193 PSMSKVIEML GPL SVPYPPKP LYS ERPSLQISYV Sbjct: 146 PSMSKVIEMLQGPLGSVPYPPKPFLYSPERPSLQISYV 183 >ref|XP_003624361.1| Ser/Thr protein kinase [Medicago truncatula] gi|355499376|gb|AES80579.1| Ser/Thr protein kinase [Medicago truncatula] Length = 424 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 306 PSMSKVIEMLLGPLQSVPYPPKPALYSLERPSLQISYV 193 P M+KVIEML GPL SVPYPPKP L+SLERP +Q+S++ Sbjct: 372 PPMNKVIEMLQGPLSSVPYPPKPVLFSLERPPVQMSHI 409 >ref|XP_003624357.1| Ser/Thr protein kinase [Medicago truncatula] gi|355499372|gb|AES80575.1| Ser/Thr protein kinase [Medicago truncatula] Length = 361 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/71 (49%), Positives = 42/71 (59%) Frame = -1 Query: 306 PSMSKVIEMLLGPLQSVPYPPKPALYSLERPSLQISYVXXXXXXXXXXXXLQENGSLKSI 127 PSMSKV+EML GPL SVPYPPKP LYS + PSLQ SY E S+ + Sbjct: 299 PSMSKVLEMLQGPLDSVPYPPKPILYSPKMPSLQSSYASSSNLL--------EKNSITLL 350 Query: 126 QQT*NENVFVM 94 + +ENV V+ Sbjct: 351 KNDISENVTVL 361