BLASTX nr result
ID: Glycyrrhiza24_contig00008249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008249 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318931.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 emb|CBI39646.3| unnamed protein product [Vitis vinifera] 62 4e-08 gb|AFW79695.1| hypothetical protein ZEAMMB73_397300 [Zea mays] 62 5e-08 ref|XP_004135569.1| PREDICTED: zinc finger CCCH domain-containin... 61 8e-08 ref|XP_002455379.1| hypothetical protein SORBIDRAFT_03g009590 [S... 61 1e-07 >ref|XP_002318931.1| predicted protein [Populus trichocarpa] gi|222857307|gb|EEE94854.1| predicted protein [Populus trichocarpa] Length = 150 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 13 MGMSWGNFPPSLQPPPEGGYPHLPFVDWG 99 MGMSWGN PPSL+PPPEGGYP LPFVDWG Sbjct: 122 MGMSWGNLPPSLKPPPEGGYPPLPFVDWG 150 >emb|CBI39646.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 62.4 bits (150), Expect = 4e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 13 MGMSWGNFPPSLQPPPEGGYPHLPFVDWG 99 MG SWGN PPSL+PPPEGGYP LPF+DWG Sbjct: 124 MGNSWGNLPPSLKPPPEGGYPPLPFLDWG 152 >gb|AFW79695.1| hypothetical protein ZEAMMB73_397300 [Zea mays] Length = 166 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 7 MGMGMSWGNFPPSLQPPPEGGYPHLPFVDWG 99 +G SWGN PPSLQPPPEGGYP LPF+DWG Sbjct: 136 LGGHASWGNLPPSLQPPPEGGYPPLPFIDWG 166 >ref|XP_004135569.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like [Cucumis sativus] gi|449508616|ref|XP_004163363.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like [Cucumis sativus] Length = 156 Score = 61.2 bits (147), Expect = 8e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 13 MGMSWGNFPPSLQPPPEGGYPHLPFVDWG 99 +G SWGN PPSL PPP+GGYP LPFVDWG Sbjct: 128 LGTSWGNLPPSLMPPPDGGYPPLPFVDWG 156 >ref|XP_002455379.1| hypothetical protein SORBIDRAFT_03g009590 [Sorghum bicolor] gi|241927354|gb|EES00499.1| hypothetical protein SORBIDRAFT_03g009590 [Sorghum bicolor] Length = 164 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 7 MGMGMSWGNFPPSLQPPPEGGYPHLPFVDWG 99 +G +WGN PPSLQPPPEGGYP LPF+DWG Sbjct: 134 LGGHTAWGNLPPSLQPPPEGGYPPLPFIDWG 164