BLASTX nr result
ID: Glycyrrhiza24_contig00008027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00008027 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600597.1| Cysteine-rich receptor-like protein kinase [... 81 8e-14 ref|XP_003552895.1| PREDICTED: cysteine-rich receptor-like prote... 71 8e-11 ref|XP_003537414.1| PREDICTED: cysteine-rich receptor-like prote... 71 8e-11 ref|XP_003537392.1| PREDICTED: cysteine-rich receptor-like prote... 71 8e-11 ref|NP_001235591.1| receptor-like protein kinase [Glycine max] g... 70 2e-10 >ref|XP_003600597.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355489645|gb|AES70848.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 682 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 501 LLCTQASAAARPTMSEIVVLLKSKKLMDHMKPSMPVFVASNLRPRVD 361 LLCTQA+AA RPTMSEIVVLLKSK M+HMKP+MPVFV SNLRPR D Sbjct: 614 LLCTQATAATRPTMSEIVVLLKSKNFMEHMKPTMPVFVNSNLRPRTD 660 >ref|XP_003552895.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like [Glycine max] Length = 649 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 501 LLCTQASAAARPTMSEIVVLLKSKKLMDHMKPSMPVFVASNLRPRVD 361 LLCTQASAA RP +SE+VVLL S L++HM+PSMP+F+ SNLRP D Sbjct: 581 LLCTQASAAMRPALSEVVVLLSSNDLLEHMRPSMPIFIESNLRPHRD 627 >ref|XP_003537414.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like [Glycine max] Length = 651 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 501 LLCTQASAAARPTMSEIVVLLKSKKLMDHMKPSMPVFVASNLRPRVD 361 LLCTQASAA RP MSE+V+LL S L++HM+PSMP+F SNL+PR D Sbjct: 583 LLCTQASAAMRPAMSEVVILLSSNDLLEHMRPSMPIFFESNLKPRND 629 >ref|XP_003537392.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like [Glycine max] Length = 641 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -2 Query: 501 LLCTQASAAARPTMSEIVVLLKSKKLMDHMKPSMPVFVASNLRPRVD 361 LLCTQASAA RP MSE+VVLL L++HM+PSMP+F+ SNLRP+ D Sbjct: 577 LLCTQASAAMRPAMSEVVVLLNCNNLLEHMRPSMPIFIESNLRPQRD 623 >ref|NP_001235591.1| receptor-like protein kinase [Glycine max] gi|223452570|gb|ACM89612.1| receptor-like protein kinase [Glycine max] Length = 287 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = -2 Query: 501 LLCTQASAAARPTMSEIVVLLKSKKLMDHMKPSMPVFVASNL 376 LLCTQASAAARPTMSE++VLLKSK L++H++P+MPVFV +N+ Sbjct: 222 LLCTQASAAARPTMSELIVLLKSKSLVEHLRPTMPVFVETNM 263