BLASTX nr result
ID: Glycyrrhiza24_contig00007952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00007952 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638289.1| hypothetical protein MTR_125s1017, partial [... 67 1e-09 ref|XP_003542849.1| PREDICTED: cellulose synthase A catalytic su... 66 3e-09 ref|XP_003540527.1| PREDICTED: cellulose synthase A catalytic su... 66 3e-09 gb|AFZ78564.1| cellulose synthase [Populus tomentosa] 65 4e-09 gb|AFZ78557.1| cellulose synthase [Populus tomentosa] 65 4e-09 >ref|XP_003638289.1| hypothetical protein MTR_125s1017, partial [Medicago truncatula] gi|355504224|gb|AES85427.1| hypothetical protein MTR_125s1017, partial [Medicago truncatula] Length = 270 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 341 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 249 LASIFSLLWVRVDPFTTRVTGPK EECGINC Sbjct: 240 LASIFSLLWVRVDPFTTRVTGPKAEECGINC 270 >ref|XP_003542849.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Glycine max] Length = 1080 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 341 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 249 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1050 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1080 >ref|XP_003540527.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Glycine max] Length = 1079 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 341 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 249 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1049 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1079 >gb|AFZ78564.1| cellulose synthase [Populus tomentosa] Length = 1061 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 341 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 249 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 1031 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1061 >gb|AFZ78557.1| cellulose synthase [Populus tomentosa] Length = 1079 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 341 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 249 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 1049 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1079