BLASTX nr result
ID: Glycyrrhiza24_contig00007941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00007941 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA92699.1| type 2A protein phosphatase-3 [Vicia faba] 73 3e-11 ref|XP_003554484.1| PREDICTED: serine/threonine-protein phosphat... 73 3e-11 ref|NP_567066.1| serine/threonine-protein phosphatase PP2A-3 cat... 72 5e-11 pir||T45670 phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 (versi... 72 5e-11 ref|NP_565974.1| serine/threonine-protein phosphatase PP2A-4 cat... 71 8e-11 >dbj|BAA92699.1| type 2A protein phosphatase-3 [Vicia faba] Length = 313 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 175 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 294 MGANS +ESTHDL+EQISQLMQCKPLSEQQVK+LCEKAK Sbjct: 1 MGANSNLAESTHDLNEQISQLMQCKPLSEQQVKELCEKAK 40 >ref|XP_003554484.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like [Glycine max] Length = 313 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 175 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 294 MGANS+ SES+HDLD+QISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSMLSESSHDLDDQISQLMQCKPLSEQQVRGLCEKAK 40 >ref|NP_567066.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|297820682|ref|XP_002878224.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata] gi|1352664|sp|P48578.1|PP2A3_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 3 gi|473259|gb|AAA64941.1| Ser/Thr protein phosphatase [Arabidopsis thaliana] gi|4204949|gb|AAD10855.1| serine/threonine protein phosphatase 2A-4 catalytic subunit [Arabidopsis thaliana] gi|15810367|gb|AAL07071.1| putative phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana] gi|16209682|gb|AAL14399.1| AT3g58500/F14P22_90 [Arabidopsis thaliana] gi|21360431|gb|AAM47331.1| AT3g58500/F14P22_90 [Arabidopsis thaliana] gi|297324062|gb|EFH54483.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata] gi|332646269|gb|AEE79790.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] Length = 313 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 175 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 294 MGANSLP+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >pir||T45670 phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 (version 2) [similarity] - Arabidopsis thaliana gi|6735367|emb|CAB68188.1| phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana] Length = 299 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 175 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 294 MGANSLP+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >ref|NP_565974.1| serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Arabidopsis thaliana] gi|297827949|ref|XP_002881857.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata] gi|1352663|sp|Q07100.2|PP2A4_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 4 gi|466441|gb|AAA64742.1| Ser/Thr protein phosphatase [Arabidopsis thaliana] gi|4567320|gb|AAD23731.1| serine threonine protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|20198072|gb|AAM15383.1| serine/threonine protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|33589738|gb|AAQ22635.1| At2g42500/F14N22.23 [Arabidopsis thaliana] gi|297327696|gb|EFH58116.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata] gi|330255033|gb|AEC10127.1| serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Arabidopsis thaliana] Length = 313 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +1 Query: 175 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 294 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAK 40