BLASTX nr result
ID: Glycyrrhiza24_contig00007223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00007223 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 696 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 10/68 (14%) Frame = -3 Query: 179 IHVNHFPI----------HRHHXXXXXXXXXXXXXXXXPIIVEDGPNDILSLQNRRYDFT 30 IHV HF H H+ PII+E+GP+DILS NRRYDFT Sbjct: 18 IHVTHFHFPTTHHRHNHNHNHNHVLPPPQSTANPITAKPIILEEGPDDILSFHNRRYDFT 77 Query: 29 PLLNFLSN 6 PLL FLSN Sbjct: 78 PLLTFLSN 85