BLASTX nr result
ID: Glycyrrhiza24_contig00006817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00006817 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9SLZ4.1|RBR1_PEA RecName: Full=Retinoblastoma-related protei... 68 7e-10 sp|A9UL14.1|RBR_MEDSA RecName: Full=Retinoblastoma-related prote... 65 4e-09 ref|XP_003627961.1| Retinoblastoma-related protein [Medicago tru... 64 2e-08 >sp|Q9SLZ4.1|RBR1_PEA RecName: Full=Retinoblastoma-related protein 1; Short=PsRB1 gi|6681366|dbj|BAA88690.1| retinoblastoma-related protein [Pisum sativum] Length = 1026 Score = 68.2 bits (165), Expect = 7e-10 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 221 MSPQAAANMEDTKPSLAPVDNGDQAESRFAEFCKNGLELDEKSFKEAMNL 370 MS A +MEDTKPS+ VDNGDQA+ RFAEF KN L LDEKS KEAM+L Sbjct: 1 MSLPAETDMEDTKPSVVMVDNGDQAQFRFAEFSKNELALDEKSCKEAMDL 50 >sp|A9UL14.1|RBR_MEDSA RecName: Full=Retinoblastoma-related protein; Short=MsRBR gi|62956049|gb|AAY23367.1| retinoblastoma-related protein [Medicago sativa] Length = 1025 Score = 65.5 bits (158), Expect = 4e-09 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 221 MSPQAAANMEDTKPSLAPVDNGDQAESRFAEFCKNGLELDEKSFKEAMNL 370 MSP MEDTKPS+ V+NGDQA SRFAEF KN L LDEKS KEAM+L Sbjct: 1 MSPSTETEMEDTKPSV--VENGDQAVSRFAEFSKNELALDEKSCKEAMDL 48 >ref|XP_003627961.1| Retinoblastoma-related protein [Medicago truncatula] gi|355521983|gb|AET02437.1| Retinoblastoma-related protein [Medicago truncatula] Length = 1052 Score = 63.5 bits (153), Expect = 2e-08 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 221 MSPQAAANMEDTKPSLAPVDNGDQAESRFAEFCKNGLELDEKSFKEAMNL 370 MSP A MEDTK L+ V+NGDQA SRFAEF KN L LDEKS KEAM+L Sbjct: 1 MSPSAETEMEDTK--LSVVENGDQAVSRFAEFSKNELALDEKSCKEAMDL 48