BLASTX nr result
ID: Glycyrrhiza24_contig00006491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00006491 (627 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613423.1| Two-component response regulator ARR3 [Medic... 67 3e-09 gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] 66 6e-09 ref|XP_003519320.1| PREDICTED: two-component response regulator ... 64 2e-08 ref|NP_001238075.1| uncharacterized protein LOC100527828 [Glycin... 64 2e-08 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 63 4e-08 >ref|XP_003613423.1| Two-component response regulator ARR3 [Medicago truncatula] gi|355514758|gb|AES96381.1| Two-component response regulator ARR3 [Medicago truncatula] Length = 237 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 617 RKSRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 516 R RCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE Sbjct: 118 RIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 151 >gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] Length = 227 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/57 (66%), Positives = 39/57 (68%), Gaps = 5/57 (8%) Frame = -2 Query: 617 RKSRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE-----XXXXXXXXXXNKRKLPEE 462 R RCLEEGAEDFIVKPVKLSDVKRLKGYMTT+E NKRKL EE Sbjct: 122 RIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTREVKVGSHDRGSGVEINNKRKLEEE 178 >ref|XP_003519320.1| PREDICTED: two-component response regulator ARR3-like [Glycine max] Length = 240 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 617 RKSRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 516 R RCLEEGAEDFIVKPVKLSDVKRLKGYMT KE Sbjct: 122 RIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTPKE 155 >ref|NP_001238075.1| uncharacterized protein LOC100527828 [Glycine max] gi|255633320|gb|ACU17017.1| unknown [Glycine max] Length = 222 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 617 RKSRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 516 R RCLEEGAEDFIVKPVKLSDVKRLK YMTTKE Sbjct: 131 RIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTTKE 164 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR3-like [Glycine max] Length = 244 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 617 RKSRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 516 R RCLEEGAEDFIVKPVKLSDVKRLKGY+T KE Sbjct: 122 RIDRCLEEGAEDFIVKPVKLSDVKRLKGYLTPKE 155