BLASTX nr result
ID: Glycyrrhiza24_contig00006433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00006433 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36865.1| WRKY domain class transcription factor [Malus x d... 134 6e-30 emb|CBI39865.3| unnamed protein product [Vitis vinifera] 134 8e-30 gb|ACQ76801.1| WRKY transcription factor 2 [Brassica napus] 134 8e-30 ref|XP_002265612.1| PREDICTED: probable WRKY transcription facto... 134 8e-30 emb|CAN72657.1| hypothetical protein VITISV_039673 [Vitis vinifera] 134 8e-30 >gb|ADL36865.1| WRKY domain class transcription factor [Malus x domestica] Length = 705 Score = 134 bits (338), Expect = 6e-30 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -1 Query: 204 GEGDESESKRRKLESYAPELSGATRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 25 GEGDESESKRRK+E+YA E+SGATR+IREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN Sbjct: 454 GEGDESESKRRKIEAYATEMSGATRAIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 513 Query: 24 PNPRSYYK 1 PNPRSYYK Sbjct: 514 PNPRSYYK 521 >emb|CBI39865.3| unnamed protein product [Vitis vinifera] Length = 622 Score = 134 bits (337), Expect = 8e-30 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -1 Query: 204 GEGDESESKRRKLESYAPELSGATRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 25 GEGDESESKRRK+E+YA E+SGATR+IREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN Sbjct: 397 GEGDESESKRRKVEAYATEMSGATRAIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 456 Query: 24 PNPRSYYK 1 PNPRSYYK Sbjct: 457 PNPRSYYK 464 >gb|ACQ76801.1| WRKY transcription factor 2 [Brassica napus] Length = 629 Score = 134 bits (337), Expect = 8e-30 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -1 Query: 204 GEGDESESKRRKLESYAPELSGATRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 25 GEGDESESKRRKLE+YA E+SGATR+IREPRVVVQTTS+VDILDDGYRWRKYGQKVVKGN Sbjct: 440 GEGDESESKRRKLEAYAAEMSGATRAIREPRVVVQTTSDVDILDDGYRWRKYGQKVVKGN 499 Query: 24 PNPRSYYK 1 PNPRSYYK Sbjct: 500 PNPRSYYK 507 >ref|XP_002265612.1| PREDICTED: probable WRKY transcription factor 2-like [Vitis vinifera] Length = 746 Score = 134 bits (337), Expect = 8e-30 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -1 Query: 204 GEGDESESKRRKLESYAPELSGATRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 25 GEGDESESKRRK+E+YA E+SGATR+IREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN Sbjct: 490 GEGDESESKRRKVEAYATEMSGATRAIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 549 Query: 24 PNPRSYYK 1 PNPRSYYK Sbjct: 550 PNPRSYYK 557 >emb|CAN72657.1| hypothetical protein VITISV_039673 [Vitis vinifera] Length = 717 Score = 134 bits (337), Expect = 8e-30 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = -1 Query: 204 GEGDESESKRRKLESYAPELSGATRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 25 GEGDESESKRRK+E+YA E+SGATR+IREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN Sbjct: 460 GEGDESESKRRKVEAYATEMSGATRAIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGN 519 Query: 24 PNPRSYYK 1 PNPRSYYK Sbjct: 520 PNPRSYYK 527