BLASTX nr result
ID: Glycyrrhiza24_contig00006230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00006230 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539148.1| PREDICTED: uncharacterized protein LOC100808... 63 2e-08 ref|XP_003516644.1| PREDICTED: uncharacterized protein LOC100780... 63 2e-08 ref|XP_002282023.1| PREDICTED: uncharacterized protein LOC100253... 61 8e-08 emb|CAB75803.1| allyl alcohol dehydrogenase-like protein [Arabid... 59 3e-07 ref|NP_567086.1| uncharacterized protein [Arabidopsis thaliana] ... 59 3e-07 >ref|XP_003539148.1| PREDICTED: uncharacterized protein LOC100808080 [Glycine max] Length = 98 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 346 YCPVSEDLEPCRWEIHPAIGSNAPQFRVVF 257 YCPVSEDLEPCRWEI PA+ SNAPQFRVVF Sbjct: 69 YCPVSEDLEPCRWEILPAVQSNAPQFRVVF 98 >ref|XP_003516644.1| PREDICTED: uncharacterized protein LOC100780185 [Glycine max] Length = 104 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 346 YCPVSEDLEPCRWEIHPAIGSNAPQFRVVF 257 YCPVSEDLEPCRWEI PA+ SNAPQFRVVF Sbjct: 75 YCPVSEDLEPCRWEILPAVQSNAPQFRVVF 104 >ref|XP_002282023.1| PREDICTED: uncharacterized protein LOC100253981 [Vitis vinifera] gi|147843023|emb|CAN83312.1| hypothetical protein VITISV_031607 [Vitis vinifera] gi|297742156|emb|CBI33943.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 346 YCPVSEDLEPCRWEIHPAIGSNAPQFRVVF 257 YCPVS+DLEPCRWEI PA GS+APQFRVVF Sbjct: 68 YCPVSDDLEPCRWEILPASGSDAPQFRVVF 97 >emb|CAB75803.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] Length = 462 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 346 YCPVSEDLEPCRWEIHPAIGSNAPQFRVVF 257 YCPVS+DLEPCRWEI PA G +APQFRVVF Sbjct: 433 YCPVSDDLEPCRWEILPADGKDAPQFRVVF 462 >ref|NP_567086.1| uncharacterized protein [Arabidopsis thaliana] gi|297820828|ref|XP_002878297.1| hypothetical protein ARALYDRAFT_486449 [Arabidopsis lyrata subsp. lyrata] gi|17473784|gb|AAL38327.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] gi|20148537|gb|AAM10159.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] gi|21553808|gb|AAM62901.1| unknown [Arabidopsis thaliana] gi|51970082|dbj|BAD43733.1| unknown protein [Arabidopsis thaliana] gi|297324135|gb|EFH54556.1| hypothetical protein ARALYDRAFT_486449 [Arabidopsis lyrata subsp. lyrata] gi|332646454|gb|AEE79975.1| uncharacterized protein [Arabidopsis thaliana] Length = 97 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 346 YCPVSEDLEPCRWEIHPAIGSNAPQFRVVF 257 YCPVS+DLEPCRWEI PA G +APQFRVVF Sbjct: 68 YCPVSDDLEPCRWEILPADGKDAPQFRVVF 97