BLASTX nr result
ID: Glycyrrhiza24_contig00005879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00005879 (946 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588905.1| hypothetical protein MTR_1g015040 [Medicago ... 61 4e-07 >ref|XP_003588905.1| hypothetical protein MTR_1g015040 [Medicago truncatula] gi|355477953|gb|AES59156.1| hypothetical protein MTR_1g015040 [Medicago truncatula] Length = 239 Score = 60.8 bits (146), Expect = 4e-07 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +3 Query: 186 MGDSKNLGLLIKKTLFSWISKFGFMGLALFAAVTSA--DKVMEAPSSGLFCITDCVTCPV 359 MG +KNLG I K+ F+W + FM L LFA T DKV E PSSGL CI++CVTCP Sbjct: 1 MGHNKNLGF-ITKSWFAWTTNIVFMLLVLFANRTLEIEDKV-EEPSSGLLCISECVTCPT 58 Query: 360 IC 365 IC Sbjct: 59 IC 60