BLASTX nr result
ID: Glycyrrhiza24_contig00005306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00005306 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546120.1| PREDICTED: F-box/kelch-repeat protein At3g23... 82 5e-14 gb|ACU22680.1| unknown [Glycine max] 82 5e-14 ref|XP_003602615.1| F-box/kelch-repeat protein [Medicago truncat... 75 7e-12 ref|XP_003638382.1| Nuclear transcription factor Y subunit A-7, ... 74 9e-12 ref|XP_003594508.1| F-box family protein [Medicago truncatula] g... 74 9e-12 >ref|XP_003546120.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine max] Length = 393 Score = 82.0 bits (201), Expect = 5e-14 Identities = 46/72 (63%), Positives = 52/72 (72%), Gaps = 4/72 (5%) Frame = -3 Query: 204 KVVAVFLVDC----KTQVSIHTLGTDSWRRIQEFPYGSPTCEPGIFISGTVNWLAFAASS 37 KVVA+F +C +TQV + TLGTDSWRRIQEFP G P E G F+SGTVNWLA SS Sbjct: 199 KVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDSS 258 Query: 36 SWPVIVSLDLGK 1 S +IVSLDL K Sbjct: 259 SL-IIVSLDLHK 269 >gb|ACU22680.1| unknown [Glycine max] Length = 393 Score = 82.0 bits (201), Expect = 5e-14 Identities = 46/72 (63%), Positives = 52/72 (72%), Gaps = 4/72 (5%) Frame = -3 Query: 204 KVVAVFLVDC----KTQVSIHTLGTDSWRRIQEFPYGSPTCEPGIFISGTVNWLAFAASS 37 KVVA+F +C +TQV + TLGTDSWRRIQEFP G P E G F+SGTVNWLA SS Sbjct: 199 KVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDSS 258 Query: 36 SWPVIVSLDLGK 1 S +IVSLDL K Sbjct: 259 SL-IIVSLDLHK 269 >ref|XP_003602615.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355491663|gb|AES72866.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 289 Score = 74.7 bits (182), Expect = 7e-12 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = -3 Query: 204 KVVAV-FLVDCKTQVSIHTLGTDSWRRIQEFPYGSPTCEPGIFISGTVNWLAF--AASSS 34 KVVAV F D +V++HTLGT+ WRRIQ+FPY PG+F+SGT+NWL + + S S Sbjct: 151 KVVAVSFFNDKNREVNVHTLGTNYWRRIQDFPYSQSIPGPGVFVSGTINWLIYDVSGSCS 210 Query: 33 WPVIVSLDL 7 + IVSLDL Sbjct: 211 FHAIVSLDL 219 >ref|XP_003638382.1| Nuclear transcription factor Y subunit A-7, partial [Medicago truncatula] gi|355504317|gb|AES85520.1| Nuclear transcription factor Y subunit A-7, partial [Medicago truncatula] Length = 455 Score = 74.3 bits (181), Expect = 9e-12 Identities = 42/74 (56%), Positives = 50/74 (67%), Gaps = 6/74 (8%) Frame = -3 Query: 204 KVVAVFLV-----DCKTQVSIHTLGTDSWRRIQEFPYGSPTCEPGIFISGTVNWLAFAAS 40 KVVAV+ D KTQV +HTLGT+ WRRI + P+G P E G F+SGTVNWLA S Sbjct: 205 KVVAVYCFESDNGDYKTQVKVHTLGTNFWRRIHDLPFGVPFDESGKFVSGTVNWLASNDS 264 Query: 39 S-SWPVIVSLDLGK 1 S + +IVSLDL K Sbjct: 265 SYTSSIIVSLDLEK 278 >ref|XP_003594508.1| F-box family protein [Medicago truncatula] gi|355483556|gb|AES64759.1| F-box family protein [Medicago truncatula] Length = 597 Score = 74.3 bits (181), Expect = 9e-12 Identities = 42/74 (56%), Positives = 50/74 (67%), Gaps = 6/74 (8%) Frame = -3 Query: 204 KVVAVFLV-----DCKTQVSIHTLGTDSWRRIQEFPYGSPTCEPGIFISGTVNWLAFAAS 40 KVVAV+ D KTQV +HTLGT+ WRRI + P+G P E G F+SGTVNWLA S Sbjct: 205 KVVAVYCFESDNGDYKTQVKVHTLGTNFWRRIHDLPFGVPFDESGKFVSGTVNWLASNDS 264 Query: 39 S-SWPVIVSLDLGK 1 S + +IVSLDL K Sbjct: 265 SYTSSIIVSLDLEK 278