BLASTX nr result
ID: Glycyrrhiza24_contig00005256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00005256 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 83 3e-14 ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot viru... 50 1e-06 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -1 Query: 319 YGQCSRALALYKQLTSCFGSKMFQATLYKEAVKKVCKLTDAVPVSIPEFMGRLGQVDFGA 140 +GQCSRAL LYKQL SCFG KMF ++LY AV+KV +L + PV+IPE RLGQVD A Sbjct: 221 FGQCSRALTLYKQLCSCFGVKMFSSSLYGMAVRKVLRLREDFPVAIPENFARLGQVDRDA 280 Query: 139 APAHVYV 119 H++V Sbjct: 281 RAVHLFV 287 >ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] gi|478364|pir||JQ2018 hypothetical 36.5K protein - strawberry latent ringspot virus gi|312511|emb|CAA49480.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] Length = 331 Score = 50.4 bits (119), Expect(2) = 1e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -1 Query: 319 YGQCSRALALYKQLTSCFGSKMFQATLYKEAVKKVCKL 206 +GQCSRAL LY+QL CFG KMF ++LY AV++ L Sbjct: 220 FGQCSRALTLYRQLCGCFGMKMFSSSLYGMAVRRFSAL 257 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 129 TSMYSFCYFSSWVCAFL-GTWALFKESKVV 43 TS+YS+ S +V GTWA FK+S ++ Sbjct: 283 TSLYSYTSSSRFVPMIRSGTWAFFKDSLII 312