BLASTX nr result
ID: Glycyrrhiza24_contig00004419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00004419 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596167.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 218 5e-55 ref|XP_003546798.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 194 5e-48 ref|XP_003596163.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 179 2e-43 ref|XP_003596162.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 172 2e-41 ref|XP_003596158.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 170 1e-40 >ref|XP_003596167.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485215|gb|AES66418.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 349 Score = 218 bits (554), Expect = 5e-55 Identities = 98/117 (83%), Positives = 106/117 (90%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GTCRFHQQD VR+EYYTRDPN+KV YVSNYSLYHDPAANWRD+LG MAP+PPK+EE P Sbjct: 99 GTCRFHQQDVMVRKEYYTRDPNKKVVYVSNYSLYHDPAANWRDSLGFSMAPNPPKSEEFP 158 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 VCRDIV+EYS KVMVFASTL ELLSEALGLNRFHLKEMGC EG ++LCHYYPPCPE Sbjct: 159 EVCRDIVIEYSEKVMVFASTLLELLSEALGLNRFHLKEMGCAEGLIVLCHYYPPCPE 215 >ref|XP_003546798.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog [Glycine max] Length = 678 Score = 194 bits (494), Expect = 5e-48 Identities = 88/117 (75%), Positives = 100/117 (85%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GTCRFHQQDAKVR+EYYTR+ +RKV Y+SNY+L+ DP+A+WRDTL +APHPP+AEE P Sbjct: 429 GTCRFHQQDAKVRKEYYTREVSRKVAYLSNYTLFEDPSADWRDTLAFSLAPHPPEAEEFP 488 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 AVCRDIV EYS K+M A LFELLSEALGLNRF+LKEM C EG LLLCHYYP CPE Sbjct: 489 AVCRDIVNEYSKKIMALAYALFELLSEALGLNRFYLKEMDCAEGQLLLCHYYPACPE 545 Score = 188 bits (477), Expect = 5e-46 Identities = 89/117 (76%), Positives = 98/117 (83%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GT RFH+QDAKVR+EYYTRD +RKV Y+SN+SLY DP+A+WRDTL AP+ P EELP Sbjct: 119 GTGRFHEQDAKVRKEYYTRDMSRKVIYLSNFSLYQDPSADWRDTLAFFWAPNSPNDEELP 178 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 AVCRDIV EYS KVM ASTLFELLSEALGL+RFHLKEMGC EG L LCHYYP CPE Sbjct: 179 AVCRDIVPEYSTKVMALASTLFELLSEALGLDRFHLKEMGCDEGLLHLCHYYPACPE 235 >ref|XP_003596163.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485211|gb|AES66414.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 391 Score = 179 bits (455), Expect = 2e-43 Identities = 83/117 (70%), Positives = 92/117 (78%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GTCRFHQQDAK R+EYYTRD +KV Y+SN++LY D +A+WRDTL PHPPKAEELP Sbjct: 117 GTCRFHQQDAKARKEYYTRDLTKKVVYLSNFTLYQDQSADWRDTLAFFWEPHPPKAEELP 176 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 VC DIV EYS +V +LFELLSEALGLNRFHLKEMG E LLCHYYPPCPE Sbjct: 177 KVCSDIVSEYSKEVKALGYSLFELLSEALGLNRFHLKEMGGAEKFFLLCHYYPPCPE 233 >ref|XP_003596162.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485210|gb|AES66413.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 381 Score = 172 bits (437), Expect = 2e-41 Identities = 80/117 (68%), Positives = 93/117 (79%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GTCRFHQQDAKVR+EYYTRD +KV Y+SN++LY D +A+WRDTL AP PPKA+ELP Sbjct: 119 GTCRFHQQDAKVRKEYYTRDLTKKVVYLSNFTLYLDQSADWRDTLAFFWAPDPPKADELP 178 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 VC DIV EY+ +VM S+L+ELLSEALGLNR HLKEMG E + LCHYYP CPE Sbjct: 179 PVCSDIVNEYTKEVMALGSSLYELLSEALGLNRSHLKEMGAAESFVHLCHYYPACPE 235 >ref|XP_003596158.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485206|gb|AES66409.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 369 Score = 170 bits (431), Expect = 1e-40 Identities = 77/117 (65%), Positives = 89/117 (76%) Frame = -3 Query: 353 GTCRFHQQDAKVRREYYTRDPNRKVNYVSNYSLYHDPAANWRDTLGCLMAPHPPKAEELP 174 GTCRFHQQD KVR+EYYTRD +KV Y+SN++L D +A WRDTL APHPP +ELP Sbjct: 113 GTCRFHQQDPKVRKEYYTRDLTKKVVYLSNFTLSEDQSAEWRDTLAFFWAPHPPNVDELP 172 Query: 173 AVCRDIVVEYSNKVMVFASTLFELLSEALGLNRFHLKEMGCGEGSLLLCHYYPPCPE 3 VC DIV EY+ +V S+L+ELLSE+LGLNRFHLKEMG E LCHYYPPCPE Sbjct: 173 PVCSDIVNEYTKEVTALGSSLYELLSESLGLNRFHLKEMGAAESFFHLCHYYPPCPE 229