BLASTX nr result
ID: Glycyrrhiza24_contig00004286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00004286 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614255.1| hypothetical protein MTR_5g047140 [Medicago ... 70 2e-10 >ref|XP_003614255.1| hypothetical protein MTR_5g047140 [Medicago truncatula] gi|355515590|gb|AES97213.1| hypothetical protein MTR_5g047140 [Medicago truncatula] Length = 590 Score = 69.7 bits (169), Expect = 2e-10 Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 14/87 (16%) Frame = +3 Query: 3 VTGASRFKKDLGAEESKFMGLNP--------------DAYDRQVPNDGSALRSEDGNIPE 140 V G+S KK +G +ESKFM N +A+DRQV N+ S LRS+D NI E Sbjct: 325 VAGSSSLKKGVGDKESKFMSSNQGAHDMQVDDDESPLNAHDRQVDNEESPLRSKDDNISE 384 Query: 141 VNSNCASFDERHGNGDGFVVHPQDGGL 221 NSN ASFDERH NG ++ QD L Sbjct: 385 ENSNGASFDERHINGHELALNTQDADL 411