BLASTX nr result
ID: Glycyrrhiza24_contig00004046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00004046 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637053.1| Translation initiation factor eIF-2B delta s... 75 6e-12 ref|XP_003554977.1| PREDICTED: translation initiation factor eIF... 72 6e-11 ref|XP_003543906.1| PREDICTED: translation initiation factor eIF... 66 3e-09 ref|XP_002521202.1| translation initiation factor 2b, delta subu... 55 6e-06 >ref|XP_003637053.1| Translation initiation factor eIF-2B delta subunit [Medicago truncatula] gi|355502988|gb|AES84191.1| Translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 693 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDP RR PRT+IDPVPK RQVGFF P APP+RS SGPPDP Sbjct: 1 MDPPRRPPRTIIDPVPKFRQVGFFTPSAPPDRSQSGPPDP 40 >ref|XP_003554977.1| PREDICTED: translation initiation factor eIF-2B subunit delta-like [Glycine max] Length = 660 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDP+PK+RQVGFF APPERS SGPPDP Sbjct: 1 MDPSRRAPRAVIDPIPKIRQVGFF---APPERSQSGPPDP 37 >ref|XP_003543906.1| PREDICTED: translation initiation factor eIF-2B subunit delta-like [Glycine max] Length = 659 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGAPPERSHSGPPDP 2 MDPSRRAPR VIDPVPK+RQVGFF APPE S SGP DP Sbjct: 1 MDPSRRAPRAVIDPVPKIRQVGFF---APPESSQSGPLDP 37 >ref|XP_002521202.1| translation initiation factor 2b, delta subunit, putative [Ricinus communis] gi|223539567|gb|EEF41154.1| translation initiation factor 2b, delta subunit, putative [Ricinus communis] Length = 638 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 121 MDPSRRAPRTVIDPVPKVRQVGFFAPGA-PPERSHSGPPDP 2 MDP RRA RTV DP KVRQVGFF PGA P+RS SGPPDP Sbjct: 1 MDP-RRASRTVSDP--KVRQVGFFTPGASSPDRSQSGPPDP 38